KEGG   Rhizobium leguminosarum bv. viciae 3841: RL3642Help
Entry
RL3642            CDS       T00402                                 

Definition
glycosyl hydrolase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
3838212..3839297
Genome map
AA seq 361 aa AA seqDB search
MRDRMNRRRFLASVPLALLYVRTGQALAQVPAAAGLRVLADRKSFRFGSAIDLQNINDPI
AAEIYIDNVNSITPRNELKWNSTEKRPGVFSFGSADRMVAFARKNNMRVYGHTLIWYRVP
GWVSDITDAKTIQATMNRHIKQVVTRYKNSIDAWDVVNEPLEYDAPDLRDCVFRRLLGDD
YIRMSFDMAHQANPGATLVLNETHLEKKSDVFEQKRARILKIVEDLVAKKTPINAVGLQA
HFRPGLDRIDPEGMGRFCAALKDMGVGVFITELDASCHFLNRDKGFTPASYADIFSEVIT
VAAEHGDLKGVTVWGMSEKYGEPDEKATDPAAACTKRVNLYDENNAPRSAVDGIRRAIEA
M
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgagagatagaatgaatagaagacgtttcctcgcctcggttccgctcgctctgttatat
gtccgtacgggccaggccctggcacaggtgcctgccgctgcagggctgcgcgtccttgcc
gacaggaagtcgttccgattcggatcggcaatcgacctgcaaaacatcaacgatccaatc
gctgccgagatctacatcgacaatgtcaattcaataacaccgcgaaacgagctgaagtgg
aattcgaccgaaaagagaccgggtgttttcagcttcggcagcgccgaccgtatggttgca
tttgcgcgcaaaaacaacatgagggtttatggccatacgctgatctggtatcgcgtcccg
ggttgggtgtctgatatcaccgacgcaaagaccattcaggcgaccatgaaccgtcatata
aaacaggttgtcactcgctataagaactcgatcgatgcatgggatgtggtgaacgaaccg
ttggagtatgatgcaccggatctgcgggattgtgttttccgacgccttcttggcgacgat
tatattcgtatgagtttcgacatggcgcaccaggccaatccgggcgcgacgctggtgctc
aacgaaacgcatctggagaaaaaatccgacgtgttcgaacagaagcgcgcgcgcatcctg
aaaatcgtcgaagatctcgtcgccaaaaaaacgccgatcaatgcggtgggtctgcaggcg
catttccgccccggcctcgaccggatcgatccggaaggaatgggacgcttctgcgcggcg
ctgaaggacatgggtgtcggcgttttcatcaccgaactggatgcgtcctgccacttcctg
aaccgcgacaaaggcttcacgccggcatcctacgccgatattttcagcgaggtgatcact
gtcgcggccgaacatggcgacttgaaaggcgtgacggtatggggcatgtcggaaaagtac
ggcgagcccgatgagaaagcgaccgatcccgctgcggcttgcacgaagcgcgttaatctc
tacgacgaaaacaatgcgccaagaagtgcagttgatgggatccggcgggcaatagaggcg
atgtga

DBGET integrated database retrieval system