KEGG   Rhizobium leguminosarum bv. viciae 3841: RL3751Help
Entry
RL3751            CDS       T00402                                 

Gene name
pssB
Definition
inositol monophosphatase involved in exopolysaccharide production
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RL3751 (pssB)
Enzymes [BR:rle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     RL3751 (pssB)
Transfer RNA biogenesis [BR:rle03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    RL3751 (pssB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
3954101..3954898
Genome map
AA seq 265 aa AA seqDB search
MLRTFEKAALEAGRAIITVLREGFPVAMKADASPVTVADEEAERIILAHLARDYPEIPVV
AEESVAAGKVPDIAGRGFFLVDPLDGTREFVDGRQEFTVNIAYIENGAPVAGIVYAPALG
LAFSGERGHAERLVVMDDFTVGARNAITVREQPDDRLALASLRHNSPETGSFLADHAIFK
CTNIGSSLKFCLLAEGKADVYPRFTRTMEWDTAAGDAVLRAAGGSTVTLDGTPLTYGKTG
TAADFDFANPNFISWGGRKRVLELA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggacatttgaaaaggcggcgctcgaagccggcagggccatcatcacggtcttg
cgcgaaggcttccccgtcgccatgaaggcggatgcaagtccggtcacggtcgccgacgag
gaggccgaacgtatcatcctcgctcatctcgccagagattatcccgaaataccggtggtg
gcggaagaatcggtcgcagccggcaaggtgcccgacatcgctggccgaggcttcttcctc
gtcgaccctctcgacggcacccgtgaattcgtcgacggacgacaggaattcaccgtcaac
atcgcctatatcgagaacggcgctccggtggccggcattgtctacgcgccggcgctgggg
cttgccttctctggagagcgcggccacgccgaaaggctcgtcgtcatggacgatttcacg
gttggcgcacgcaacgcaatcacggtgcgcgaacagccggacgacaggctggcgcttgca
agccttcgccacaacagcccggagaccggaagcttcctcgccgaccacgcgatcttcaaa
tgcaccaatatcggttcctcgttgaagttctgcctgctggccgaaggcaaggcagacgtc
tatccgcgtttcacccgcacgatggaatgggacaccgcggccggggatgcggtgctgcgc
gccgccggcggttcgacggtgacgctggacggaacgccgctgacctacggcaagacggga
acggccgccgatttcgacttcgccaacccgaacttcatctcctggggtggcaggaaacgc
gtcctcgaactggcgtga

DBGET integrated database retrieval system