KEGG   Rhizobium leguminosarum bv. viciae 3841: RL3801Help
Entry
RL3801            CDS       T00402                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    RL3801
  Lipid metabolism
   00600 Sphingolipid metabolism
    RL3801
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    RL3801
Enzymes [BR:rle01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     RL3801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
4012848..4014950
Genome map
AA seq 700 aa AA seqDB search
MLNKDIQLPYGAVYFRKSNPPREDWERDYATAGQDGLNIFRHWFMWSAIETAPGVYDWEE
YDRQMDLAAANGIKTVIAELIHAVPDWAVRKYAHALQVNADGTKLGSYMGVSSATGGFSN
NGGGAGALTLNCPEVKEAAGKFLTALATRYKDHPAIYGYDVWNECNYSADVDYSPYAKAA
FRKWLEKKYGSLKALAKAWYRYSYAEWDDIEPPVHMAPYPECIDWLQFKRDNFYDQMQWR
IDTIRAVDQKNTIVAHGISGAIPNMAANGCDDWLAASKVEVYGFTWIQARKGSEAWKNWY
GVDINRAAARGKPFWHAERQGGPLWLQPQVIGRDKEDGRVVEPEDIRLWSMTSLAGGARG
VINLRWRPLLDGPLFGAFGSYGMDGSRTPRSDMASTMAKWANDKAQGPLWEAKPVRGEVG
ILVVRETQEFDYLLNHDRKEKPYPQAMWGAYRAFLENGAQPDWVHIDDIAAYDFLYFPYP
IMFTSEQAKSLNAWVENGGTLIAEACPGYFGDRGHVGTVQPNMGLDEVFGAREEEVEFMP
DIGDRIHFDLDGAAVDGGGFLQSYRLTGGTGRGHFTDGRLAVVENAYGKGRTLLIGTNPS
VAYYRTQGKANGAFFAELLRWSGKKRHVTLSNAALFARIHEGEKGSFLWLVNPTRAAQKT
EVTLAEGALAQSQAVWPIDHIGNSGIEVPPRDVLILPLDS
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgctcaacaaagatatccagctgccctacggcgccgtctatttccgcaagtcgaatccg
ccccgcgaggattgggaacgcgactacgccaccgctgggcaagacggcctcaacatcttc
cgccactggttcatgtggagcgcgatcgaaaccgcccccggcgtctacgattgggaggaa
tatgaccgccagatggatcttgccgccgcaaacggcatcaaaaccgttatcgccgagctg
attcatgccgtgccggactgggcggtacgcaaatatgctcatgcattgcaggtcaatgcc
gacggcaccaaactcggctcctatatgggtgtgtcgtcggcgaccggcggtttctccaac
aatggtggcggcgccggcgccctgacgctgaactgccccgaagtaaaggaagcagcgggg
aagttcctgaccgcgctcgccacccgctacaaggatcatccggcgatctatggctacgac
gtctggaacgaatgcaactattccgccgatgtcgattacagcccctatgccaaggccgcc
tttcgcaaatggctcgaaaagaaatacggcagcctgaaggccctggccaaggcctggtac
cgctacagctatgccgaatgggacgatatcgagccgccggtgcatatggcgccctatccc
gaatgcatcgactggctgcagttcaagcgcgacaatttctacgatcagatgcaatggcgc
atcgacacgatccgcgccgtcgaccagaagaacaccatcgttgcccacggcatatccggc
gcgattcccaacatggcggccaacggctgcgacgactggctcgccgcctccaaggtcgag
gtttacggcttcacctggatccaggcccgcaagggatcggaagcctggaagaactggtac
ggcgtcgacatcaaccgcgctgccgcccgcggcaagccgttctggcacgccgagcgccag
ggcggaccactctggctgcagccgcaggtgatcggccgcgacaaggaagatggccgcgtc
gtcgagcccgaggatatccgcctctggagcatgacctcgcttgccggcggcgcccgcggc
gtgatcaatctgcgctggcgcccgctgctcgacggtccgctcttcggcgctttcggctcc
tacggcatggacggctcgcgcacgccgcgctctgacatggcaagcaccatggcgaaatgg
gcaaatgacaaggcgcaaggccccctctgggaagcaaagcccgtgcgcggcgaggtcggc
atcctcgtcgttcgcgaaacgcaggagtttgattatctcctgaaccacgaccgcaaggag
aaaccctatccccaggccatgtggggcgcctatcgggccttcctcgaaaacggcgcgcag
ccggactgggtgcatatcgacgacatcgcggcctatgatttcctctatttcccctatccg
atcatgtttacatcggaacaggcaaagagcctgaatgcctgggtcgaaaacggcggcacg
ctcattgccgaggcatgccccggctatttcggcgatcgcggccatgtcggcaccgtgcag
ccgaacatgggcctcgacgaggtttttggtgcgcgagaggaagaggtcgagttcatgccc
gatatcggcgaccgcatccatttcgatctcgacggcgcggcggtcgacggtggcggcttc
ctgcagtcttatcggctgaccggcggaacgggacgcggccacttcaccgacggccgtctt
gccgtcgtcgaaaatgcctatggcaagggccgcacgctgctgatcggcaccaatccttcc
gtggcctattaccgcacgcaggggaaggcaaacggcgctttcttcgctgagctattgaga
tggagcgggaagaagcgccacgtgacgctatcgaatgccgcactcttcgcccgtatccac
gagggagaaaagggcagcttcctctggctcgtcaatccgacaagggcggcgcagaagacc
gaggtgacgctagccgaaggagcgcttgcgcaaagccaggccgtctggccgatcgatcat
atcggcaatagtggcatcgaggtgccgccgcgcgatgtgctgatcctgccgctcgatagc
tga

DBGET integrated database retrieval system