KEGG   Rhizobium leguminosarum bv. viciae 3841: RL3920Help
Entry
RL3920            CDS       T00402                                 

Definition
hypothetical protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
complement(4149193..4149657)
Genome map
AA seq 154 aa AA seqDB search
MANRLQKGSAAAAMAVALVGSFEGLRQNAYPDPATQGQPWTICYGSTNGVKPGDRKTVEQ
CKALLSLELQTYAAGIERCVRVTLPDARFVALTSFAYNVGIKAACGSSAVRLINQGRTAE
GCEALLKWNRAAGIVFPGLTRRRQKERQFCLEGV
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaccgcctgcagaagggtagcgccgcggctgcaatggctgttgcgctcgtcgga
tcgttcgaagggctgaggcagaacgcctatcccgatccggccacgcaaggccagccgtgg
accatctgctacggcagcaccaatggcgtgaagcccggcgaccgaaagacggtcgagcag
tgcaaggcgcttctctcgctcgagctgcaaacctatgcggccggcattgagcgctgcgtg
cgcgttaccctgccggatgcgcggttcgtcgctctgacctcatttgcctacaatgtgggc
atcaaggcggcctgcggttcgagcgcggtcagactcatcaaccagggcaggacggctgag
ggttgcgaggccctgttgaagtggaaccgggccgcggggattgtcttccccggcctaacc
cgccggcggcagaaggaacgccagttctgcttggagggcgtgtga

DBGET integrated database retrieval system