KEGG   Rhizobium leguminosarum bv. viciae 3841: RL3989Help
Entry
RL3989            CDS       T00402                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rle00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RL3989 (ruvA)
Enzymes [BR:rle01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     RL3989 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
4214909..4215523
Genome map
AA seq 204 aa AA seqDB search
MIGKLKGTIDEIGEDYVLVDVHGVCYVAHCSARTLSKLGSTGEACVLFIETYVREDQLKL
FGFMTALEREWFNLLQSVQGVGAKVALAVLSTLPPGELANAIALQDRTAVSRAPGVGPKV
AMRLVTELKNRAPAFAGEAINIGLKQELGEGVAAAPVADAVSALTNLGYSRDQAANAIAA
AMKTAGEGADSAKLIRLGLKELAR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaagctgaaaggcaccatagacgagatcggcgaagactatgtgctcgtcgat
gtgcacggcgtctgctacgtcgcccattgttcggcccgcaccctatccaagctaggctcg
actggtgaggcctgcgtgctgttcatcgagacctatgtgcgcgaggatcagctgaagctc
ttcggtttcatgaccgcgctggagcgggaatggttcaacctgctccagagcgttcagggc
gtcggcgccaaggtagcgctcgccgtgctctcgacgctgcccccaggcgaactggcgaat
gcgatcgccctgcaggatcgcaccgccgtctcccgtgccccgggcgtcggtcccaaggtg
gcgatgcgcctcgtcaccgaactcaagaaccgggcgccggcctttgccggtgaggcgatc
aatatcggcctcaagcaggaactcggcgaaggtgtcgcggcagcaccggtcgccgatgcg
gtttccgcgctgaccaacctcggctattcccgcgaccaggcggcaaatgcgattgccgcg
gcaatgaagacggcaggcgaaggtgctgacagcgccaagctgatcaggctggggttgaag
gaactggcgcggtga

DBGET integrated database retrieval system