KEGG   Rhizobium leguminosarum bv. viciae 3841: RL4028Help
Entry
RL4028            CDS       T00402                                 

Gene name
cheB
Definition
chemotaxis two-component response regulator protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rle00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RL4028 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    RL4028 (cheB)
Enzymes [BR:rle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     RL4028 (cheB)
Two-component system [BR:rle02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   RL4028 (cheB)
Bacterial motility proteins [BR:rle02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    RL4028 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
complement(4256058..4257155)
Genome map
AA seq 365 aa AA seqDB search
MAKKIRVLIIDDSASIRQTLTHVLEQDPDIEIMAVASDPFMAARKLQEEIPDVITLDVEM
PRMDGITFLRKLMSQRPIPVVMCSSLTEAGSETLLQALEAGAVDVILKSKIGAADSLSDD
AMRIREVVKSASHARLSNVRRAAGTIRSASVEGPAKKLTADVMLPPPTGRAMAKTTEMVV
CVGASTGGTEALREFLEELPANAPGMVIVQHMPEKFTAAFAKRLNGLCEVEVKEAVDGDP
VLRGHVLIAPGDKHMLLERQGARYYVSVKTGPLVSRHRPSVDVLFRSAARSAGSNAMGII
MTGMGDDGARGMLEMHQAGAYTVAQDEASSVVFGMPKEAIAKGGVDRILPLDQIAREVLI
TQQKF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaaaattcgcgttctcatcatcgacgattccgccagcatccgccagacgctg
acgcatgtgctggagcaggatcccgatatcgagatcatggcggtcgcatccgacccgttc
atggcggcgcggaagttgcaggaagagatccccgatgtcatcacgctcgacgtcgagatg
ccgcgcatggatggcatcaccttcctgcgcaagctgatgtcgcagcggccgatccctgtc
gtgatgtgttcgtcgctgacggaggcgggatcggaaacgctgctccaggcgctggaggcc
ggtgccgttgacgtcatcctgaagtcgaagatcggcgccgccgacagcctttccgacgac
gcgatgcgtattcgcgaagtcgtcaagagcgcttcgcatgcacggctttccaacgtccgc
cgcgccgccggaaccatccgctcggcctcagtggaagggccggccaagaagctgacggcg
gatgtgatgctgccgccgccgacggggcgggccatggcgaagacgacggagatggtcgtc
tgcgtcggcgcctccaccggcggcacggaagcgctgcgcgagttcctggaggaactgccg
gccaatgcacctggcatggtgatcgtccagcatatgccggagaaattcaccgccgccttc
gccaagcggctgaacgggctctgcgaggttgaggtcaaggaagccgtcgatggcgatccg
gtgctgcgcggccatgtgctgatcgcgccaggcgacaagcacatgctgctcgagcgccag
ggtgcgcgctactatgtgagcgtcaagaccgggccgctggtgtcgcgccaccggccttcc
gtcgacgtgctcttccgctcggcggcgcgctcggccggctcgaacgccatgggaatcatc
atgaccggcatgggcgatgacggcgcgcgcggcatgctggaaatgcatcaggccggcgcc
tacacggtggcgcaggacgaggcgagttctgttgttttcggcatgccgaaggaggcgatc
gccaaaggcggcgtcgatcggatcctgccgctcgaccagatcgcccgcgaagtactgata
acgcagcagaagttttaa

DBGET integrated database retrieval system