KEGG   Rhizobium leguminosarum bv. viciae 3841: RL4081Help
Entry
RL4081            CDS       T00402                                 

Gene name
exoN
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:rle00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rle00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rle00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rle00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
complement(4310854..4311741)
Genome map
AA seq 295 aa AA seqDB search
MAQHNKVRKAVFPVAGLGTRFLPATKAVPKEMLTVVDKPIIQYVVDEAIEAGIEHLVFVT
GRNKHVIEDYFDIHFELEQTLRERAKKAEITLLAQQLPKAGTVSFTRQQEPLGLGHAVWC
AREIVGDEPFALLLPDMIMKGDKGCMKGMIDLYAQSGGNIIAVEECAPDQAHKYGIVGVG
EAIGDGFRITGMVEKPAKGTAPSNFFINGRYILQPEIFKILETQERGAGNEIQLTDGMLK
LLKEQDFAGYHFRGATYDCGAKDGFILANVAFALERADIRPSVEGGFRELLAGLK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaacacaacaaagttcgtaaagcagtatttccggttgccggattgggaacgcga
ttcctgccggcgacaaaggctgttccgaaggaaatgttgaccgtcgtcgacaagccaatc
attcaatatgtcgtcgatgaggcgattgaggcggggatcgaacatctggtcttcgtcacc
ggacgcaacaagcacgtcatcgaagattatttcgacattcatttcgagctggagcagacg
ctgcgcgagcgcgcgaaaaaggcggaaattacgcttctcgcccagcaattgccgaaggcc
ggcacggtgagcttcacccgccagcaggagcctctcggcctcggccacgccgtgtggtgt
gcgcgtgagatcgtcggcgacgagcccttcgcactgttgctgcccgatatgatcatgaag
ggtgacaagggctgcatgaagggcatgatcgacctctatgcccagagcggcggcaatatc
atcgccgtcgaggaatgcgcgccggatcaggcgcataaatacggcatcgtcggcgtcggc
gaggcgatcggcgacggcttccgcatcaccggcatggtggaaaagcctgccaaggggacg
gcgccttccaacttcttcatcaacggccgctatatcctgcagcctgagatcttcaagatc
ctcgaaacccaggagcgcggcgccggcaacgagatccagctcaccgacggcatgttgaag
ctgctgaaggaacaggatttcgccgggtaccatttccgcggcgcgacctacgactgcggc
gcaaaggacggcttcatcctggcgaacgtcgccttcgccctcgaacgcgccgatatccgc
ccctccgtcgaaggcggcttcagggaactgcttgccggcctgaaataa

DBGET integrated database retrieval system