KEGG   Rhizobium leguminosarum bv. viciae 3841: RL4081Help
Entry
RL4081            CDS       T00402                                 

Gene name
exoN
Definition
(GenBank) putative UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00040  Pentose and glucuronate interconversions
rle00052  Galactose metabolism
rle00500  Starch and sucrose metabolism
rle00520  Amino sugar and nucleotide sugar metabolism
rle01100  Metabolic pathways
rle01130  Biosynthesis of antibiotics
Module
rle_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RL4081 (exoN)
   00052 Galactose metabolism
    RL4081 (exoN)
   00500 Starch and sucrose metabolism
    RL4081 (exoN)
   00520 Amino sugar and nucleotide sugar metabolism
    RL4081 (exoN)
Enzymes [BR:rle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RL4081 (exoN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 DNA_mis_repair
Motif
Other DBs
NCBI-ProteinID: CAK09570
GeneDB: RL4081
RhizoBase: RL4081
UniProt: Q1MBW3
Position
complement(4310854..4311741)
Genome map
AA seq 295 aa AA seqDB search
MAQHNKVRKAVFPVAGLGTRFLPATKAVPKEMLTVVDKPIIQYVVDEAIEAGIEHLVFVT
GRNKHVIEDYFDIHFELEQTLRERAKKAEITLLAQQLPKAGTVSFTRQQEPLGLGHAVWC
AREIVGDEPFALLLPDMIMKGDKGCMKGMIDLYAQSGGNIIAVEECAPDQAHKYGIVGVG
EAIGDGFRITGMVEKPAKGTAPSNFFINGRYILQPEIFKILETQERGAGNEIQLTDGMLK
LLKEQDFAGYHFRGATYDCGAKDGFILANVAFALERADIRPSVEGGFRELLAGLK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaacacaacaaagttcgtaaagcagtatttccggttgccggattgggaacgcga
ttcctgccggcgacaaaggctgttccgaaggaaatgttgaccgtcgtcgacaagccaatc
attcaatatgtcgtcgatgaggcgattgaggcggggatcgaacatctggtcttcgtcacc
ggacgcaacaagcacgtcatcgaagattatttcgacattcatttcgagctggagcagacg
ctgcgcgagcgcgcgaaaaaggcggaaattacgcttctcgcccagcaattgccgaaggcc
ggcacggtgagcttcacccgccagcaggagcctctcggcctcggccacgccgtgtggtgt
gcgcgtgagatcgtcggcgacgagcccttcgcactgttgctgcccgatatgatcatgaag
ggtgacaagggctgcatgaagggcatgatcgacctctatgcccagagcggcggcaatatc
atcgccgtcgaggaatgcgcgccggatcaggcgcataaatacggcatcgtcggcgtcggc
gaggcgatcggcgacggcttccgcatcaccggcatggtggaaaagcctgccaaggggacg
gcgccttccaacttcttcatcaacggccgctatatcctgcagcctgagatcttcaagatc
ctcgaaacccaggagcgcggcgccggcaacgagatccagctcaccgacggcatgttgaag
ctgctgaaggaacaggatttcgccgggtaccatttccgcggcgcgacctacgactgcggc
gcaaaggacggcttcatcctggcgaacgtcgccttcgccctcgaacgcgccgatatccgc
ccctccgtcgaaggcggcttcagggaactgcttgccggcctgaaataa

DBGET integrated database retrieval system