KEGG   Rhizobium leguminosarum bv. viciae 3841: RL4090Help
Entry
RL4090            CDS       T00402                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    RL4090
Enzymes [BR:rle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RL4090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
4325556..4326680
Genome map
AA seq 374 aa AA seqDB search
MHRPFFFSLNFGRPRAPSCSRRPFSPTAFQAGCHALSLMRSSQQRRIGKVMDQVLYSTPD
NPAPENRTEGFFETHDGHQLRYAVFRSSGQIAKGTVVILHGRNEYIEKYFETIRDLTAKG
LWVATFDMRGQGGSPRLLKSRNHGHIRRFVDYERDLDTFLEKVVLPDTRLPFYLLAHSTG
GLIALSAAPYLTTRIDRMVLSAPFIGLTGQSASPRVIRALAGTLTALGLGFLPLTSKLKE
PNFSDNPLTSDEHRFERNVAMMKTHPELTLGPPTARWLIEAFRTMDRVTSPNHLFSITIP
TIVIAPTRDGVVPYTAQERLSRYFRAGQLVPINGARHEIFQERDIYRAAALAAFHAFIPG
SDAEENQDVAALGT
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgcatcgtcccttcttcttcagtctcaacttcggccggccgcgagcaccctcatgctcc
cgccggcccttttcccccaccgctttccaagccggatgccatgcgctatccctgatgcga
agcagtcagcagcggcgcattggcaaagtcatggatcaggttctctattcgacgcccgat
aatcccgccccggaaaaccgcacggaggggttcttcgaaacccatgacggccaccagctg
cgttacgccgtcttccgctcgagtggccagattgccaagggcaccgtcgtcatcctgcac
ggccgaaacgaatatatcgagaaatatttcgaaaccatccgcgacctcacggccaaaggc
ctctgggtcgcgaccttcgatatgcgtggccagggcggttcgccgcggctcctgaagagc
cgcaaccacggccacatccgccgcttcgtcgattacgagcgtgatctcgataccttcctg
gaaaaggtagtgctgccggatacccgcctgcccttctatctgctggcgcattccaccggc
ggcctgatcgcactctcggccgccccctatctcaccacccgtatcgatcgcatggtgctg
tcggcgcccttcatcggcctgaccggccagtcggcctcgccccgcgtcatccgcgctctc
gccggcacgctgaccgccctcggcctcggcttcctgccgctgacctcgaaactgaaggag
ccgaacttcagcgacaacccgctgacctcggacgaacaccgattcgagcgcaatgtcgcg
atgatgaagacccatccggaattgacgctcggaccgccaacggcccgctggctgatcgag
gctttccgcacgatggaccgggtcacctcacccaatcatctcttctcgatcaccatcccg
accatcgtcatcgccccgacgcgcgacggtgtcgtgccctacacggcgcaggagcggctt
tcacgttatttccgcgccggccagctagtgccgatcaacggcgcccgtcacgagatcttc
caggaacgggatatctaccgcgccgccgcccttgcggccttccacgccttcattcccggc
agcgatgccgaagaaaaccaggacgtcgccgccctcggcacgtga

DBGET integrated database retrieval system