KEGG   Rhizobium leguminosarum bv. viciae 3841: RL4115Help
Entry
RL4115            CDS       T00402                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rle00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
4355121..4357328
Genome map
AA seq 735 aa AA seqDB search
MKTPKTVPEVKLSWEISADEITAILAGSHSNPFAVLGVHQAGDAFVARCFIPGAEEVTAM
TLDGGVIGELKQLHADGVFAGPVSLTKLQPVRYRARRGDAEWAVTDPYSFGPVLGPMDDY
FAREGSHLRLFDKMGAHLIKHDGAQGIHFAVWAPNAQRVSVVGDFNNWDGRRHVMRFRSD
SGIWEIFAPDVPIGVAYKFEIRGQDGVLLPLKADPFARRSELRPKTASVTAAELEQEWED
EAHLKHWRETDKRRQPISIYEVHAASWQRRQDGTMLSWDELASSLIPYCADMGFTHIEFL
PITEYPYDPSWGYQTTGLYAPTARFGEPEGFARFVNGCHKVGIGVILDWVPAHFPTDEHG
LGWFDGTALYEHEDPRKGFHPDWSTAIYNFGRTEVVSYLVNNALYWAEKFHLDGLRVDAV
ASMLYLDYSRKHGEWIPNEYGGNENLEAVRFLQDLNIRIYGKNSNVMTIAEESTSWPKVS
QPVHEGGLGFGFKWNMGFMHDTLSYMSRDPIYRGHHHNELTFGLLYAYSENFVLPLSHDE
VVHGKGSLIAKMPGDDWQKFANLRAYYAYMWGYPGKKLLFMGQEFAQWSEWSEEKALDWN
LLQYRMHEGMRRLVRDLNFTYRSKPALHARDCEGEGFEWLVADDHQNSVFAWLRKAPGQK
PVAVITNFTPIYRENYSIRLPSAGRWREILNTDADIYGGSGKGNGGRVQAVDAGGNITCS
ITLPPLATIMLEPEN
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgccgaaaaccgtccctgaagtaaagctttcctgggaaatttcggcagatgaa
atcacggcaatccttgccggttcgcattccaatccctttgccgtcctaggtgtgcaccag
gccggcgacgctttcgtcgccagatgcttcatcccgggcgccgaggaggtgaccgccatg
acgctcgacggcggcgtcatcggcgaactgaagcagctccatgccgacggcgtctttgcc
ggcccggtttccctcacaaagctccagccggtgcgttaccgcgcccggcgcggcgatgcc
gaatgggctgtcaccgatccctatagcttcggtccggtgctcggaccgatggacgattat
ttcgcccgcgagggctcgcacctgcgcctgttcgacaagatgggcgcccacctcatcaag
catgacggcgcgcagggcatccatttcgccgtctgggcgccgaacgcgcagcgcgtctcg
gtcgtcggtgatttcaacaattgggacggccgccgccacgtcatgcgcttccgctcggat
agcggcatctgggaaatctttgcccctgacgtaccgatcggcgttgcctacaagttcgag
atccgcggccaggacggcgtattgctgccgctgaaggccgatcccttcgcgcgccgcagc
gagctgcggccgaagaccgcctcggtcaccgccgccgagctggagcaggagtgggaagac
gaggcccatctgaagcactggcgcgagaccgacaagcgccgccagccgatctcgatctac
gaggtgcatgccgcctcctggcaacgccggcaggacggcacgatgctgtcctgggacgag
ctcgcctccagcctcatcccctattgcgcagacatgggcttcacccatatcgaattcctg
ccgatcaccgagtacccctacgacccctcctggggttaccagacgaccggcctctatgcg
ccgaccgctcgtttcggcgagccggagggttttgcccgtttcgtcaacggctgccacaag
gtcggcatcggcgtcatcctcgactgggtgccggcgcattttccgaccgacgaacacggt
ctcggctggttcgacggcacggcactctacgagcacgaagatccgcgcaagggcttccac
ccggactggagcacggcgatctacaatttcggccgcaccgaggtcgtttcctatcttgtc
aacaacgcgctctactgggccgaaaaattccacctcgacggtctgcgtgtcgatgccgtc
gcttcgatgctctacctcgattattcgcgcaagcacggcgagtggatcccgaacgaatat
ggcggcaacgagaacctcgaagcggtccgttttctgcaggatctcaacatccgcatctat
ggcaaaaattccaacgtcatgaccatcgccgaggaatcgacctcctggccgaaggtctcg
cagcccgttcatgaaggcggcctcggcttcggcttcaagtggaacatgggcttcatgcac
gacacgctgagctacatgagccgtgatcccatctatcgcgggcaccatcacaacgaactc
accttcggcctgctctacgcctattcggaaaatttcgtcctgccgctctcgcatgacgag
gttgtgcacggaaaaggctcgctgatcgccaagatgccgggcgacgactggcagaagttc
gccaatctgcgtgcctactacgcctatatgtggggctatcccggcaagaagctgctgttc
atgggccaggaattcgcccagtggagcgagtggagcgaagagaaggcactcgactggaac
ctgcttcagtatcgcatgcacgagggcatgcggcgcctggtccgcgatctcaatttcacc
tatcgcagcaagccggcgctgcatgcgcgtgactgcgagggcgaaggtttcgaatggctg
gtcgccgacgaccaccagaattccgtctttgcctggctacgcaaggcgccgggccagaag
ccggtcgccgtcatcaccaatttcacccctatctatcgcgagaattactcgatccgcctg
ccgtccgcagggcgctggcgggaaatcctgaacaccgatgccgacatctacggcggcagc
ggcaagggcaatggcgggcgcgtgcaggccgtcgatgccggcggcaacatcacctgctcg
attaccttgccgcccttggcgacaatcatgcttgaacctgaaaattag

DBGET integrated database retrieval system