KEGG   Rhizobium leguminosarum bv. viciae 3841: RL4222Help
Entry
RL4222            CDS       T00402                                 

Gene name
exoI
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rle00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:rle00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
complement(4473177..4475087)
Genome map
AA seq 636 aa AA seqDB search
MADYLLEASWSPIEGSFGRLTFTLFNLSTEPLSGFSLAYTSETRVADKHVCDGGSLKRQV
AHFHEFLPPEGLSVPPGGRWRFTVEGLTRAPKHMTSGVKSAYLTLGDGRHVSVGFGDLML
EGRDGGVAPPILPPGRAEEPYSLLPWPLALGLKAGELPVVLYPAEPTRPDAVKALSLVLE
LYQRLYPADNVPFSLSAVEGGRAIRFVIESSIAAFAYELRFTAHEIMLSSADAAGRHYGL
ISLAQLLHGARADRERFKFPSFGTIADQPRYDWRGCHLDVSRQFYPVADVVRLIDILAWN
KLNIFHWHLADDEAWRLEIKAYPALTEIGARRGPDEVLVPQLGDGAQTRSGHYTQQDARR
IVAHAASLHIEVVPEIDIPGHSMATLFSLPELVDGQEAPDSYRSVQGYPNNALNPAVEFT
YEFLGKVFDEMVTLFPGEYLHIGGDEVAHGSWLSSPLCKALMEREKLTGTAELQSYFLKR
IKAMLSERGKKLVGWNEVSHGGGVDRDGTLLMAWEKPEVGIELAQQGYDVVMTPGQAYYL
DMAQAEAWAEPGASWAGHAPPEHTYAYEAEGELPEVLREKMRGIQACIWTENFLSRAYFN
RLVFPRLPAVAEAAWTPSARKDWDRFAAIVRMWPVL
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggccgattaccttctggaagcaagctggagcccgatcgagggcagtttcgggcgcctc
accttcacgcttttcaatctttcgaccgagccgctgtccggcttctcgctcgcctatacg
tcggagacgcgggttgccgacaaacatgtctgtgacggcggcagcctcaagcggcaggtc
gcgcatttccatgaattcctgccgcccgaggggctgagcgtgccgcccggcgggcgctgg
cggttcacggtcgagggactgaccagggcgccgaaacatatgacatcaggcgtcaagtcg
gcctatctgacacttggcgacgggcgccacgtttctgttggtttcggcgatctcatgctc
gaaggccgggatggtggcgtggcgccgcccattctgccgccgggccgggccgaggaaccc
tattcgctgctgccctggccgctggcgctcgggctgaaggcgggagagctgccggtcgtc
ctttatccggccgagccgacgcggcccgatgcggtcaaggcgctctcgctggttctggag
ctctatcagcggctctatccggccgacaatgtgccgttttccctcagtgccgtcgaaggc
gggcgggccattcgtttcgtcatcgaatcgtcgatcgccgccttcgcttacgaattgcgt
tttacggcgcatgagatcatgctttcgagtgccgatgccgccgggcggcactacgggctg
atcagcctggcgcaattgctgcacggcgctcgcgccgatcgcgagcgcttcaaattcccc
agtttcggcacgatcgccgaccagccgcgttatgactggcgcggctgccatctcgatgtg
tccaggcagttttatccggtggcggacgtcgtgcggctgattgatattctcgcctggaac
aagctcaacatcttccactggcatctggccgatgacgaagcgtggcggctggagatcaag
gcctatccggcgctgacggagatcggcgcccggcgtgggccggatgaagtgctcgtgccg
cagctcggcgacggggcgcaaacgcgctccggccattacacacagcaggacgccaggcgg
atcgttgcgcatgcagcctcgttgcatatcgaagtggtgccggaaatcgatattcccggc
catagcatggcgacactgttctcactgcccgagctcgtcgacggccaggaggcgccggac
agttaccgctcggtgcagggttatccgaacaacgccctcaatccggcggtggaattcacc
tatgaatttctcggcaaggtgttcgacgaaatggtgacgctgtttcccggcgaatatctc
catatcggcggcgacgaagtggcgcatggctcctggctttcctcgccgctttgcaaggca
ctgatggagagggagaaacttaccggcaccgccgagctgcaatcctatttcctgaagcgt
atcaaagccatgctgtccgagcgcggcaagaaactcgtcggttggaacgaggtctcgcat
gggggcggggtcgatcgcgacggcacgctgctgatggcctgggaaaagcccgaggtcggt
atcgagctcgcacagcaaggttacgacgtggtgatgacaccggggcaagcctattatctc
gacatggcgcaggcggaggcctgggccgagccgggcgccagctgggcgggccacgcaccg
ccggaacatacctacgcttacgaggccgagggcgagctgccggaagtgctaagggagaag
atgcgcggtatccaggcctgcatctggaccgagaacttcctctcgcgcgcctatttcaac
cggctggtttttccgcgcctcccggccgtcgccgaagccgcctggacgccttctgcgcgc
aaggactgggatcgcttcgcagcgatcgtgcgaatgtggccggtgctttaa

DBGET integrated database retrieval system