KEGG   Rhizobium leguminosarum bv. viciae 3841: RL4372Help
Entry
RL4372            CDS       T00402                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:rle00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
4641869..4643059
Genome map
AA seq 396 aa AA seqDB search
MMTGKSAPRRLSIFGSTGSIGQNTLNVVDHLGGRENFEISVLTGSGNVELLARQAKSSGA
RLAVTANDRHYESLKSELSGTGIAVASGKSGLMEAADRDVDWVMAAIVGTAGLAPTLAAA
RRGADIALANKECLVSAGDLFIAAIREGGGRLLPVDSEHNAIFQVLEENQRHAVERVILT
ASGGPFRTASLRDMADVTVETARAHPNWSMGLKISIDSASMFNKALEMIEALHLFSLRPE
QIEVIFHPQSIIHSMVGYTDGSVLAQLGAPDMRTAIGYALSFPRRPNLPVERLDFAKLAR
LDFEAPDEVRFPALRLARLAMTRGGVQGAVLNGAKEVALEAFIEGRLSFLAMAEVTERVM
DDLAGLPQAAGMDDVFAADREARQRAAELMTLAIAE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccggcaaaagcgcgccgcggcgcctcagcatcttcggttcgacgggttcgatc
ggccagaatacactcaatgtcgtcgatcacctgggcggacgggagaacttcgaaatctcc
gtgctcacaggcagcggcaatgtcgaattgctggcccggcaggcgaaatcatccggcgcg
cggctggcggtgacggcaaacgaccgccattacgaatcactgaagagcgaactttccggc
accggcatcgcggtagcctcgggaaaatccggcctgatggaagccgccgaccgcgacgtc
gactgggtgatggcagcaatcgtcggcactgcgggcctggcgccgacgcttgccgctgcc
cgccgcggcgccgatatcgcccttgccaacaaggaatgcctggtatcggccggcgatctc
tttatcgcagcgatccgcgaaggcggcggcaggctgcttcccgtcgacagcgagcacaac
gccatcttccaggtgctggaagagaaccagcgccacgccgtcgagcgggtcatcctgacg
gcgtcgggtggccccttccgcaccgcctcgctgcgtgacatggcggatgtgacggtggaa
actgcgcgcgcccacccgaactggtcgatgggattgaagatctcgatcgacagcgcctcg
atgttcaacaaggcgctggagatgatagaagccctgcaccttttcagcctcagacccgaa
cagatcgaggtcattttccatccgcaatcgatcatccactccatggtcggctataccgat
gggtcggtgctggcgcagctcggcgcgcccgatatgcgcaccgccatcggttatgccctg
tcctttccgcgccggccgaacctgccggtcgagcggctggatttcgccaagctcgcccgg
ctggatttcgaggcgccggatgaggtgcggtttccggcgctgcggctcgcgcgcctggcg
atgacacgcggcggtgttcagggcgccgtgctgaacggcgccaaggaagtggcgctcgaa
gccttcatcgaagggcggctctccttcctcgccatggccgaggtgactgagagggtcatg
gacgatctggccggcctgccgcaggctgccggcatggacgatgtcttcgccgccgacagg
gaagcccggcaaagggcggcggaactcatgacactagcgatcgccgagtga

DBGET integrated database retrieval system