KEGG   Rhizobium leguminosarum bv. viciae 3841: RL4384Help
Entry
RL4384            CDS       T00402                                 

Gene name
arcA
Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rle01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rle00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
4661262..4662197
Genome map
AA seq 311 aa AA seqDB search
MNAQSRSVTLIGAPLEEGSGRRGAAMGPAALRIAGVDQTLIELGHDVADIGDLRIVPAMD
LPNHPKAHNLRIVGAFTRALESSVHDVAASGRFPLILGGDHSLSMGSVSGMARYAAGKGR
PLFVLWLDAHADFNSPATSPSGNIHGMPVAFFCGEAEFAEILPKDRPFVDPKNVFQVGIR
SVDAREREEIHEHGVNVFDMRAIDEQGIGAIMREILDVVIKANGLLHVSLDLDFLDPEIA
PGVGTTVPGGATFREAHLVMEMLSDSGLVSSLDLVELNPFLDDRGKSARILVELTASLFG
RRIFDRPTRAA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgcaatcgcgatctgtcaccctcatcggcgcgccgctggaagaaggctccggc
cgcagaggggctgccatgggccctgcggccctgcgtattgccggcgtcgaccagacgctg
atcgagcttggccatgacgtcgccgatatcggcgatctcaggatcgtgccggcgatggac
ctgccgaaccacccgaaggcccacaacctgaggatcgtcggcgccttcacgcgcgcgctg
gaaagcagcgtccacgacgtggccgcctccggccgtttcccgctcattctcggcggcgac
cacagcctttccatgggcagcgtctccggcatggcccgttatgccgccggcaaaggccgc
ccgctcttcgtgctctggctcgatgcccatgccgatttcaactctccagccacgtcgcct
tccggcaatattcacggcatgcccgtcgccttcttctgcggcgaggcagagttcgccgag
atcttgccgaaggaccgtccgttcgtcgatccgaagaacgtcttccaggtcggcatccgt
tcggtcgatgcgcgcgagcgcgaggaaatccacgaacacggcgtcaatgtcttcgacatg
cgcgcgatagacgagcagggcatcggcgccatcatgcgtgagatcctcgatgtcgtcatc
aaggcgaacggcctgctgcatgtcagcctcgacctcgatttcctcgatcccgagatcgct
cccggtgtcggcacgacggtgcctggcggtgcgacctttcgcgaggcgcatctggtgatg
gaaatgctttcggacagcggcctcgtctcgtcgctcgatctcgtcgagctcaatccgttt
ctcgacgatcgcggcaagagcgcccgcatcctggtcgagctgacggcaagcctgtttggc
cgccgcatcttcgatcgtccgacacgcgccgcatag

DBGET integrated database retrieval system