KEGG   Rhizobium leguminosarum bv. viciae 3841: RL4384Help
Entry
RL4384            CDS       T00402                                 

Gene name
arcA
Definition
(RefSeq) arginase
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RL4384 (arcA)
  Amino acid metabolism
   00220 Arginine biosynthesis
    RL4384 (arcA)
   00330 Arginine and proline metabolism
    RL4384 (arcA)
Enzymes [BR:rle01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     RL4384 (arcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
4661262..4662197
Genome map
AA seq 311 aa AA seqDB search
MNAQSRSVTLIGAPLEEGSGRRGAAMGPAALRIAGVDQTLIELGHDVADIGDLRIVPAMD
LPNHPKAHNLRIVGAFTRALESSVHDVAASGRFPLILGGDHSLSMGSVSGMARYAAGKGR
PLFVLWLDAHADFNSPATSPSGNIHGMPVAFFCGEAEFAEILPKDRPFVDPKNVFQVGIR
SVDAREREEIHEHGVNVFDMRAIDEQGIGAIMREILDVVIKANGLLHVSLDLDFLDPEIA
PGVGTTVPGGATFREAHLVMEMLSDSGLVSSLDLVELNPFLDDRGKSARILVELTASLFG
RRIFDRPTRAA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgcaatcgcgatctgtcaccctcatcggcgcgccgctggaagaaggctccggc
cgcagaggggctgccatgggccctgcggccctgcgtattgccggcgtcgaccagacgctg
atcgagcttggccatgacgtcgccgatatcggcgatctcaggatcgtgccggcgatggac
ctgccgaaccacccgaaggcccacaacctgaggatcgtcggcgccttcacgcgcgcgctg
gaaagcagcgtccacgacgtggccgcctccggccgtttcccgctcattctcggcggcgac
cacagcctttccatgggcagcgtctccggcatggcccgttatgccgccggcaaaggccgc
ccgctcttcgtgctctggctcgatgcccatgccgatttcaactctccagccacgtcgcct
tccggcaatattcacggcatgcccgtcgccttcttctgcggcgaggcagagttcgccgag
atcttgccgaaggaccgtccgttcgtcgatccgaagaacgtcttccaggtcggcatccgt
tcggtcgatgcgcgcgagcgcgaggaaatccacgaacacggcgtcaatgtcttcgacatg
cgcgcgatagacgagcagggcatcggcgccatcatgcgtgagatcctcgatgtcgtcatc
aaggcgaacggcctgctgcatgtcagcctcgacctcgatttcctcgatcccgagatcgct
cccggtgtcggcacgacggtgcctggcggtgcgacctttcgcgaggcgcatctggtgatg
gaaatgctttcggacagcggcctcgtctcgtcgctcgatctcgtcgagctcaatccgttt
ctcgacgatcgcggcaagagcgcccgcatcctggtcgagctgacggcaagcctgtttggc
cgccgcatcttcgatcgtccgacacgcgccgcatag

DBGET integrated database retrieval system