KEGG   Rhizobium leguminosarum bv. viciae 3841: RL4384Help
Entry
RL4384            CDS       T00402                                 

Gene name
arcA
Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RL4384 (arcA)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RL4384 (arcA)
Enzymes [BR:rle01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     RL4384 (arcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
4661262..4662197
Genome map
AA seq 311 aa AA seqDB search
MNAQSRSVTLIGAPLEEGSGRRGAAMGPAALRIAGVDQTLIELGHDVADIGDLRIVPAMD
LPNHPKAHNLRIVGAFTRALESSVHDVAASGRFPLILGGDHSLSMGSVSGMARYAAGKGR
PLFVLWLDAHADFNSPATSPSGNIHGMPVAFFCGEAEFAEILPKDRPFVDPKNVFQVGIR
SVDAREREEIHEHGVNVFDMRAIDEQGIGAIMREILDVVIKANGLLHVSLDLDFLDPEIA
PGVGTTVPGGATFREAHLVMEMLSDSGLVSSLDLVELNPFLDDRGKSARILVELTASLFG
RRIFDRPTRAA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgcaatcgcgatctgtcaccctcatcggcgcgccgctggaagaaggctccggc
cgcagaggggctgccatgggccctgcggccctgcgtattgccggcgtcgaccagacgctg
atcgagcttggccatgacgtcgccgatatcggcgatctcaggatcgtgccggcgatggac
ctgccgaaccacccgaaggcccacaacctgaggatcgtcggcgccttcacgcgcgcgctg
gaaagcagcgtccacgacgtggccgcctccggccgtttcccgctcattctcggcggcgac
cacagcctttccatgggcagcgtctccggcatggcccgttatgccgccggcaaaggccgc
ccgctcttcgtgctctggctcgatgcccatgccgatttcaactctccagccacgtcgcct
tccggcaatattcacggcatgcccgtcgccttcttctgcggcgaggcagagttcgccgag
atcttgccgaaggaccgtccgttcgtcgatccgaagaacgtcttccaggtcggcatccgt
tcggtcgatgcgcgcgagcgcgaggaaatccacgaacacggcgtcaatgtcttcgacatg
cgcgcgatagacgagcagggcatcggcgccatcatgcgtgagatcctcgatgtcgtcatc
aaggcgaacggcctgctgcatgtcagcctcgacctcgatttcctcgatcccgagatcgct
cccggtgtcggcacgacggtgcctggcggtgcgacctttcgcgaggcgcatctggtgatg
gaaatgctttcggacagcggcctcgtctcgtcgctcgatctcgtcgagctcaatccgttt
ctcgacgatcgcggcaagagcgcccgcatcctggtcgagctgacggcaagcctgtttggc
cgccgcatcttcgatcgtccgacacgcgccgcatag

DBGET integrated database retrieval system