KEGG   Rhizobium leguminosarum bv. viciae 3841: RL4445Help
Entry
RL4445            CDS       T00402                                 

Gene name
sdhD
Definition
(GenBank) putative succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00020  Citrate cycle (TCA cycle)
rle00190  Oxidative phosphorylation
rle00650  Butanoate metabolism
rle01100  Metabolic pathways
rle01110  Biosynthesis of secondary metabolites
rle01120  Microbial metabolism in diverse environments
rle01130  Biosynthesis of antibiotics
rle01200  Carbon metabolism
Module
rle_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rle_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rle_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RL4445 (sdhD)
   00650 Butanoate metabolism
    RL4445 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RL4445 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Pox_F16 Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: CAK09931
GeneDB: RL4445
RhizoBase: RL4445
UniProt: Q1MAV4
Position
complement(4727059..4727439)
Genome map
AA seq 126 aa AA seqDB search
MDMRTPLGKVRGLGSAKDGTDHFWRQRLTAVANVPLILFFVFFMLAYAGAPYADVVRALS
NPFVAVVMGLMVISGVIHMKLGMQVIIEDYVHGEFGKVALLMLNTFFAILIAGLCLFAIL
KIAFVG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggatatgcgcacccctctcggcaaggttcgcgggcttggctccgccaaggacggcacg
gaccatttctggcgccagcggctgacggccgtcgccaatgttccgctcatcctcttcttc
gtcttcttcatgctcgcctatgccggcgcgccctatgcggatgtggttcgcgcgctgtcg
aaccccttcgtcgcggtggtcatggggctgatggtgatctcgggcgtcatccacatgaag
ctcggcatgcaggtcatcatcgaggattacgtgcatggcgaattcggcaaggtcgctctc
ctgatgctgaacacgttctttgcgatcctgatcgccggcctctgtctcttcgccattctg
aaaatcgcattcgtaggataa

DBGET integrated database retrieval system