KEGG   Rhizobium leguminosarum bv. viciae 3841: RL4489Help
Entry
RL4489            CDS       T00402                                 

Definition
glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rle00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:rle00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
complement(4771892..4773571)
Genome map
AA seq 559 aa AA seqDB search
MTIYDELRKAPFNLDDAAISWVRDVYASLDLDDKIGQLFTLIMIGTDEEDFKRIASLRPG
GVTRFFTADLEFERRVISDLVAKSKVPPIISADLEGSRHSFAFGTPVLGQLGLAAVDDVQ
ATEKSSEILAREGRAMGVRWSFTPVIDINAAFRSPIVGTRSYGSDVSKIERHAVAHVHGL
QRNGVAATAKHWPGEGYDDRDQHLVTTTNPLSMDEWKETFGRLYRTLITEGVLAIMSGHI
SLPAYIRSKMPDAGLEAFRPASVSRLLNVDLLRDELGFNGIIVSDATPMGGLSAWGHHLD
TLPDIIANGCDMILFSDAPEEDMAAVKAAVEDGRITQERLEEAVLRVLALKAHLKLFQPS
DVLPDEAEVRHLLAHPDSVAASREYIGRSPTLVKDVNGIFPLDPAKTKRVLLVDGGIIHP
LMPQPLEFLLPALLRKEGFEVTIDRPDIVPTPDDFDLVLYTLGDESLLVRGRIFVDWHRM
GGGGLFKAMYRPWTNIPSAMISFGHPYHLYDAPRVPAYINAYSTMDSVQEAVVDCMLGRK
PFLGTNPVDPFCGLEDARY
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgacgatctacgacgagcttcgcaaagcgccgttcaacctcgacgacgctgcgatatcc
tgggtccgcgacgtctatgcctcgctcgatctcgatgacaagatcggccaactcttcacc
ttgatcatgatcgggacggatgaagaggatttcaaacgcattgcttcattaaggccgggc
ggcgtaacccgcttcttcacggctgacctcgagttcgagcggcgggtcatctctgacctc
gtggccaagagcaaagtcccgcccatcatcagcgcagaccttgaaggcagccgtcattcc
tttgctttcggcacgcccgtgctgggacaacttggccttgccgccgtcgacgacgttcag
gcgaccgagaaaagttcggaaatcttggcgcgcgagggccgcgcgatgggcgtgcgttgg
tccttcacgccagtcatcgatataaatgccgcgttccgatcgccgattgtcggtacacgg
tcatacggctccgatgtcagcaagattgagcggcacgcggttgcccatgttcacggtctc
caacgcaatggcgttgccgccaccgcaaagcactggccgggcgagggatatgacgaccgc
gatcagcacctcgttacgacgaccaatccgctttccatggacgagtggaaggaaaccttc
ggtcggctctatagaacgctgatcaccgaaggcgtgttggcaataatgagcggacacatt
tcccttccggcctatattcgatcgaagatgccagatgccgggcttgaagctttccgaccg
gcctcggtttcccggttgctgaacgttgatcttctccgagacgaactcggcttcaatggc
atcattgtctctgacgcgacacccatgggagggctgtctgcctggggccaccacctcgat
acgctgcctgatatcatcgcgaatggctgcgacatgatcctcttcagcgatgcacctgag
gaggatatggcggcggtcaaggctgccgtcgaagatgggcgaattactcaggagcgactt
gaggaagcagttcttcgcgtgctggcgctcaaggcgcatctcaagctttttcaaccgtca
gatgtcctccccgatgaggcggaagtgcgccacctgcttgcgcatccagacagtgtcgct
gcatcaagggaatacatcggccgctcgcctacgcttgtgaaggacgtcaatggtatcttc
ccgctcgatccggcgaaaacaaagcgcgtactgctggtcgacggcggcatcattcatccg
ctcatgccgcagccactggaattcttgctacctgcgctgttgcggaaggaaggtttcgaa
gtcacgatcgaccgaccggacatcgtgccgacccccgacgacttcgacctcgtcctctac
acgctaggcgacgagtcgctgctcgtccgaggccggatattcgtcgactggcataggatg
ggtggtgggggccttttcaaggccatgtaccgaccctggacgaatattccctccgcaatg
atctcatttgggcatccctatcacctttacgatgcgccgcgcgtaccggcctatatcaat
gcgtactccaccatggacagcgtccaggaagccgtcgttgattgtatgcttggtcgcaag
cctttcctcggcaccaacccggtagaccctttctgtggccttgaagatgcgcgttattga

DBGET integrated database retrieval system