KEGG   Rhizobium leguminosarum bv. viciae 3841: RL4529Help
Entry
RL4529            CDS       T00402                                 

Definition
lipase/arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    RL4529
Enzymes [BR:rle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RL4529
   3.1.2  Thioester hydrolases
    3.1.2.-  
     RL4529
Lipid biosynthesis proteins [BR:rle01004]
 Fatty acid synthase
  Component type
   RL4529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
complement(4808549..4809193)
Genome map
AA seq 214 aa AA seqDB search
MRFKVAALQFTVIAVSLIFATAADARTINLVGFGDSLMAGYQLPPGDGFPEKLQAALKAK
GLDVTIANAGVSGDTTTGGLARIDWSVPDGTDGVILELGANDALRGIPPEESEKNLDQMI
TRLKERGIAVLLAGMMAPPNMGADYAARFNPIYQKLSEKHGLPLYAFFLDGVALEAGLKL
EDGMHPNARGVDVMVEKMEPAVTNFVEAISSVKN
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgagatttaaagttgccgcccttcaattcaccgtcatcgccgtctcgctgatctttgct
actgcagccgatgcccggacgatcaatctcgtcggttttggggatagtttgatggcgggt
tatcagttgccgcccggcgacggctttccggaaaagcttcaggcggccctgaaggcgaag
gggctcgatgtcaccatcgccaatgccggggtttccggagacacgacgacaggcggtctt
gcgcgcatcgactggtcggtacccgacggcaccgatggggtcattctcgagcttggcgcc
aatgatgcgctgcggggcatcccgccggaagagagcgagaagaatctcgaccagatgata
acccggctaaaggagcgcggaattgccgtgctgctcgccggcatgatggcgccgccgaac
atgggggcggattatgccgcacgattcaacccgatctaccagaagctctcggaaaaacat
gggcttcccctctacgcctttttcctcgacggcgtcgcgctggaggcggggttgaagctc
gaggacggcatgcatccaaatgcgagaggtgtcgacgtcatggtcgaaaagatggagcct
gctgtcacaaatttcgtcgaagcgatttcttctgtgaagaattag

DBGET integrated database retrieval system