KEGG   Rhizobium leguminosarum bv. viciae 3841: RL4682Help
Entry
RL4682            CDS       T00402                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RL4682 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RL4682 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    RL4682 (proB)
Enzymes [BR:rle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     RL4682 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
4984897..4986099
Genome map
AA seq 400 aa AA seqDB search
MRARTRVETRAMTSRKPLGRYRRIVIKIGSALLVDRKAGLKKAWLDAMCADISGLKAKGI
DVLVVSSGAIALGRSVLDLPSGALKLEESQAAAAVGQIALARAWSESLSRDEIVAGQILL
TLGDTEERRRYLNARATINQLLKIGAVPIINENDTVATSEIRYGDNDRLAARVATMTGAD
LLILLSDIDGLYTAPPHLDPNATFLETIAEITPEIEAMAGGAASELSRGGMRTKIDAGKI
ATASGCAMIIASGKTENPLSAIENGARSSWFAPSGTPVTARKTWIAGQLQPAGELHVDDG
AVTALGAGKSLLPAGVRSVSGLFSRGDTVAIIGPAGREIARGLVSYDADDARRIAGRKSA
EIETILGYPGRAAMVHRDDMVMTAQIGSKSERQKKDASYA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgaggacaagggtggagacgagggcgatgaccagccgtaagccgcttggccgc
taccgccgcatcgtcatcaagatcggatccgcgcttctggtcgaccgcaaggccgggctg
aagaaggcctggctcgacgccatgtgcgccgatatctccggcctgaaggccaagggtatc
gacgtgctcgtcgtgtcctcgggcgcaatcgcgctcggccgctcggtgctcgacctgccc
tccggcgcgctgaagcttgaggaaagccaggcggcggcggccgtcggccagatcgcgctg
gcccgcgcctggtcggaaagcctgtcgcgcgacgagatcgtcgccggccagatcctgctg
acgctcggcgataccgaggagcgccgtcgctatctcaatgcgcgcgccaccatcaatcag
cttttgaagatcggcgccgtgccgatcatcaatgaaaacgacacggtcgccaccagcgag
atccgctacggcgacaacgaccggctggccgcccgcgtcgcgacgatgaccggcgccgat
ctgctcattcttctctccgatatcgacggtctctacaccgcgccgccccatctcgatccg
aacgcaacgttccttgagacgattgctgaaatcacccccgagatcgaggcaatggccgga
ggcgcggcctccgagctttcgcgtggcggcatgcgtaccaagatcgatgccggcaagatt
gcgacggcatcaggctgcgcgatgatcatcgcctccggcaagaccgagaaccctctgtcg
gcgatcgaaaacggcgcgcgttcctcctggtttgcgccgtcgggcacacccgttaccgcc
cgcaagacctggattgccggacagctgcagccggccggcgaactgcatgtcgatgacggc
gccgtcacagccctcggcgccggcaagagcctgcttcccgccggcgttcgcagcgtttcc
ggcctcttcagccgcggcgacacggtggcgatcatcggcccggccggccgcgagatcgcc
cgcggcctggtaagctacgatgccgacgacgcccgtcggattgccggccgcaagtcggcg
gagatcgagaccattctcggttatcccggacgcgccgccatggtccatcgcgacgacatg
gtgatgaccgcgcagatcggttcgaaatcggaaaggcagaagaaggacgcgagctatgct
tga

DBGET integrated database retrieval system