KEGG   Rhizobium leguminosarum bv. viciae 3841: RL4713Help
Entry
RL4713            CDS       T00402                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rle00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:rle00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rle02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
complement(5016412..5018166)
Genome map
AA seq 584 aa AA seqDB search
MRTLLAAFAATTILAGAAQATTVYPLDRATILAGSPFDFKVELNKQVKLEDVKITVNGQD
YKTVLGGEAQFVELEKGKDDKALGSAILLRGLKISAPGDYKIEVAAGDETKSVTWKVYET
AAQPKAKNIIFLLGDGLSVAHRTAARIMSKGMTEGKANGRLNMDDLERMAFIGTSATNAV
DTDSANTMSAYMTGHKTAVNAIGVYADRTPASLDDPRVETFAEAVRRLTRKSIGIVATAE
VEDATPAAVVAHTRNRNDKADVVGMLLDVKPEVLLGGGSAYFLGKEVAGSKRKDNQDYIK
QFQDAGYKLATDKNELAANASAEGNLLGLFHTGNMDVTLDREFLKKGTVDKFPNQPGLVA
MTKVALDRLSKNPDGFFLMVEGSSIDKMSHPLDWDRAVIETIEFDQAIGVAREFQKAHPD
TLIVVTGDHTHGVSIIGTVDDEKPGTEMREKVGIYAEAGFPNYKDENGDGYPDKIDVSRR
LFLSANNGPDHYETFRPKLDGPFVPAVQNEKKEYVANEQYKDVPGAVFVQGNIPKSGDSG
VHAADDVVLQSAGPGAEAFHGYMEQSDVYRVLADTFALGAKQTN
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacgcttcttgccgcctttgcggccaccaccatccttgcgggcgccgctcaggcg
acgacggtctatccgcttgatcgcgcgacgatccttgccggttcgccgttcgatttcaag
gtcgagctcaacaagcaggtcaagctcgaagacgtgaagatcacggtcaacggccaggac
tacaagaccgtgcttgggggcgaggcgcagttcgtcgaactggaaaagggcaaggacgac
aaggctctcggttccgctatcctgttgcgcggcctgaagatttccgctcctggcgactac
aagatcgaagtggccgccggcgacgaaacgaagtccgtcacctggaaggtttacgaaaca
gcggcccagccgaaggcaaagaacatcatcttcctgctgggtgacggcctctccgttgcg
catcgcaccgctgcccgcatcatgtccaagggcatgaccgaaggtaaggcgaatggccgc
ctgaatatggatgatctcgagcgtatggcttttatcggcacgtcggcgacgaatgccgtc
gatacggactcggccaacaccatgtcggcctacatgacgggtcacaagacggccgtcaac
gcgatcggcgtttacgcggaccgtacgccggcctccctcgatgatccgcgtgttgaaacc
ttcgcagaagccgttcgccgcctgaccaggaagtcgatcggcatcgttgcaacggccgag
gtcgaagacgccacgccggctgcggtcgttgctcacacccgcaaccgcaacgacaaggcc
gacgtcgtcggcatgctgctcgacgtcaagccggaagtcctcctcggcggcggctcggcc
tatttcctcggcaaggaagtcgccggctccaagcgcaaggataatcaggactacatcaag
cagttccaggatgccggctacaagcttgccaccgacaagaacgaactcgcagccaatgca
tcggctgaaggcaatctcctcggtctcttccacaccggcaatatggacgtcacgcttgat
cgcgagttcctgaagaagggtaccgtcgacaagttcccgaaccagccgggcctcgtcgcc
atgaccaaggttgcgctcgaccgcctctccaagaatcctgatggtttcttcctgatggtc
gaaggttcctcgatcgacaaaatgtcccatccgctcgattgggatcgtgccgtcatcgaa
accatcgaattcgaccaggccatcggcgttgcccgcgaattccagaaggcccatccggac
acgctgatcgtcgtcacaggcgaccacacacatggcgtatccatcatcggtaccgtcgat
gatgaaaagcccggcacggaaatgcgcgaaaaggtcgggatctatgccgaagccggcttc
ccgaattacaaggacgaaaacggcgacggctatcccgataagatcgacgtcagccgccgc
ctgttcctgagcgccaacaatggccccgatcactacgagaccttccgtccgaagctcgat
ggtccgttcgttccggcggtccagaacgaaaagaaggaatatgtcgccaacgaacagtat
aaggatgttcccggcgcggtcttcgttcagggcaatattccgaagagcggcgatagtggc
gtccacgcagccgacgatgtcgtcctgcagtcggctggtccgggtgccgaagctttccat
ggttacatggaacagagcgacgtctatcgcgtgctcgccgacaccttcgccctcggcgcc
aagcagacgaattga

DBGET integrated database retrieval system