KEGG   Rhizobium leguminosarum bv. viciae 3841: RL4727Help
Entry
RL4727            CDS       T00402                                 

Gene name
acs
Definition
(GenBank) putative acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00010  Glycolysis / Gluconeogenesis
rle00620  Pyruvate metabolism
rle00640  Propanoate metabolism
rle00680  Methane metabolism
rle01100  Metabolic pathways
rle01110  Biosynthesis of secondary metabolites
rle01120  Microbial metabolism in diverse environments
rle01130  Biosynthesis of antibiotics
rle01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RL4727 (acs)
   00620 Pyruvate metabolism
    RL4727 (acs)
   00640 Propanoate metabolism
    RL4727 (acs)
  Energy metabolism
   00680 Methane metabolism
    RL4727 (acs)
Enzymes [BR:rle01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RL4727 (acs)
Lipid biosynthesis proteins [BR:rle01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RL4727 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAK10210
GeneDB: RL4727
RhizoBase: RL4727
UniProt: Q1MA30
Position
complement(5037147..5039102)
Genome map
AA seq 651 aa AA seqDB search
MSEKIYPVTKPVKARALIDKEKYLKWYEESVENPDKFWGKHGKRIDWFKPYTKVKNTSFT
GKVSIKWFEDGQTNVSYNCIDRHLKTNGDQVAIIWEGDNPYVDKKVTYNELYEYVCRMAN
VLKKHGVKKGDRVTIYMPMIPEAAYAMLACARIGAVHSVVFGGFSPEALAGRIVDCESTF
VITCDEGVRGGKPVPLKDNTDTAIHIAARQYVNVTKVLVVRRTGGKTGWAPGRDLWYHQE
IATVKAECPPVKMKAEDPLFILYTSGSTGKPKGVLHTTAGYLVYAAMTHEYVFDYHDGDV
YWCTADVGWVTGHSYIVYGPLANCATTLMFEGVPNFPDQGRFWEVIDKHKVNIFYTAPTA
IRSLMGAGDDFVTRSSRSSLRLLGTVGEPINPEAWEWYYNVVGDKRCPVIDTWWQTETGG
HMITPLPGATDLKPGSATTPFFGIKPQLVDNEGKVLEGAADGNLCITDSWPGQMRTVYGD
HERFIQTYFSTYKGKYFTGDGCRRDADGYYWITGRVDDVLNVSGHRLGTAEVESALVSHN
LVSEAAVVGYPHPIKGQGIYCYVTLMSGHEGSDTLRQELVKHVRAEIGPIAAPDKIQFAP
GLPKTRSGKIMRRILRKIAEDDFGALGDTSTLADPAVVDDLIANRQNKATA
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagaagatctatccggtcacgaagccggtgaaggcgcgcgccctgatcgataag
gaaaagtacctgaaatggtacgaggaaagcgtcgagaacccggacaagttctggggcaag
cacggcaagcggatcgactggttcaagccctataccaaggttaagaacacttcctttacc
ggcaaggtttcgatcaagtggttcgaggacggtcagacaaacgtctcctataattgcatc
gaccgccatctgaaaacgaatggcgaccaggtggcgatcatctgggagggcgacaacccc
tatgtcgataagaaggtcacctataacgagctctacgagtatgtctgccggatggcgaac
gtcttgaagaagcacggcgtcaagaagggcgatcgcgtcaccatctacatgccgatgatt
cccgaagccgcctatgcgatgctcgcctgcgcccgcatcggcgcggtgcattcggtcgtc
ttcggcggtttctcgccggaggccttggcggggcgtatcgtcgactgcgaatccaccttc
gtcattacctgtgacgaaggcgtgcgcggcggcaagccggtgccgctgaaggacaatacc
gatacggcgatccatatcgccgctcgccagtatgtcaatgtcaccaaggtgctggtcgtt
cgccgcaccggcggcaagaccggctgggctcccggccgcgatctctggtatcaccaagaa
attgccacggtgaaggcggaatgcccgccggtgaagatgaaggcggaagatccgctcttc
attctttatacgtcaggctcgaccggcaaaccgaagggcgtgctgcacacgaccgccggt
tatctcgtctatgcagcgatgacgcatgaatatgtcttcgattatcacgacggcgatgtc
tactggtgtacggccgatgtcggctgggtgaccggccattcctatatcgtctacgggccg
cttgcgaactgcgcgacgacgctgatgttcgagggcgtgccgaatttcccggatcagggc
cgtttctgggaagtcatcgacaagcacaaggtcaacatcttctataccgcgccgacggcg
atccgctcgctgatgggtgccggtgacgacttcgtcactcgctcctcgcgctcgtcgctg
cgcctgctcggcacggtcggcgagccgatcaatccagaggcctgggaatggtattacaat
gtcgtcggtgacaagcgctgccccgtcattgatacgtggtggcagacggaaaccggcggc
catatgatcacgccgctgcctggcgccaccgatctgaaacccggttcggcgacgaccccg
ttcttcggcatcaagccgcagctggtcgacaatgagggcaaggtgctggaaggcgcggcc
gatggcaatctctgcatcaccgacagctggccgggccagatgcgcacggtctatggcgat
cacgagcgcttcatccagacctatttctccacatacaagggcaagtatttcaccggcgat
ggctgccggcgcgatgctgacgggtactactggatcaccggccgcgtcgacgacgtgctg
aacgtctccggccaccggctgggcacggcggaggtggaatccgccctcgtctcgcacaat
ctggtttcggaagccgcagtcgtcggttacccgcatccgatcaagggccagggcatttat
tgctatgtgacgctgatgtccggccacgagggatcggacacgcttcgccaggaactggtg
aaacatgtgcgggccgaaatcggcccgatcgccgcgcccgacaagatccagtttgcgccc
ggcctaccgaagacccgctccggcaagatcatgcgccgcatcctgcgcaagatcgccgaa
gacgatttcggtgctctcggtgacacttcgacccttgccgatccggcagtcgtcgacgat
cttatcgccaaccggcagaacaaggcgaccgcctga

DBGET integrated database retrieval system