KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL100135Help
Entry
pRL100135         CDS       T00402                                 

Definition
(GenBank) putative 1,3-propanediol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00010  Glycolysis / Gluconeogenesis
rle00071  Fatty acid degradation
rle00350  Tyrosine metabolism
rle00625  Chloroalkane and chloroalkene degradation
rle00626  Naphthalene degradation
rle01100  Metabolic pathways
rle01110  Biosynthesis of secondary metabolites
rle01120  Microbial metabolism in diverse environments
rle01130  Biosynthesis of antibiotics
rle01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    pRL100135
  Lipid metabolism
   00071 Fatty acid degradation
    pRL100135
  Amino acid metabolism
   00350 Tyrosine metabolism
    pRL100135
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    pRL100135
   00626 Naphthalene degradation
    pRL100135
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     pRL100135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: CAK10358
GeneDB: pRL100135
RhizoBase: pRL100135
UniProt: Q1M814
Position
pRL10:130847..132022
Genome map
AA seq 391 aa AA seqDB search
MREELMTINPFEFRTVPSMEMAWGGAKRIGQIIAARFAARKVLLVTDAGLVKAGMIAPIA
ASLEAAGFSVAIFDKVVADPPESVLYGCVEEARQVAADIVIGLGGGSSLDIAKLAAVLLS
SEQSLADMYGVGKVQGARFPLVLVPTTAGTGSEVTNISIITTGETTKMGVVSPELYADFV
LLDAELTVGLPQVHTAATGIDAMVHAIEAYTSKHKKNPLSDALAREALRLLGRNLIAACK
EPSNRDAREGMLLGATLAGQAFSNSPVAAVHALAYPLGGHYHIPHGLSNALMLGPVLRYN
AQAAAPLYAELADVLGVTGSGDATARSEYFVAHMQVLMDESGAPRRLRDVGVTDNSLAML
AADAMKQTRLLVNNPVEVREEDALALYREAF
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagggaggagttaatgacgatcaatccattcgaatttcgaactgtcccatccatggag
atggcttggggcggagctaaacgaataggtcaaatcatcgctgcgcgtttcgctgcgcgc
aaggtgcttttggtcaccgacgcgggcctggtgaaggctgggatgattgcacccattgcc
gccagtctggaggcggctggtttcagtgtggcgattttcgacaaggttgtggccgatcca
ccggaaagcgttttgtatggttgtgtcgaggaggcgcggcaagtcgcagccgatattgtc
attggtctcggtggtggctcgtccttggacatagccaagctagcggcggtgctgctatca
tcagaacaatcactcgccgatatgtatggtgtcggcaaagttcagggcgcgcgcttccca
ctcgttctcgttccgacgacggcaggcacaggttccgaagttaccaatatttccatcatc
accacaggcgagacgaccaagatgggggtcgtgtcgccggagctatacgcggatttcgtg
ctgctggatgcagaacttaccgtcggtttgccgcaggttcacaccgccgcaactggtatc
gatgcgatggtgcacgccattgaagcctataccagcaagcacaagaaaaacccgctttcg
gatgcgttggcacgcgaagccctgcggctgctcggccgcaatcttattgctgcctgcaag
gagccttccaatcgggatgctcgtgaaggcatgcttctcggtgcaactcttgcgggccag
gccttctccaactccccggtggctgccgtccacgcattggcctatccgttgggtggacat
tatcacattccgcatggtctttcgaacgctctgatgctcggtccagtccttcgctacaat
gcgcaggcagctgccccgctttacgccgagcttgccgatgtgcttggcgtcacgggaagc
ggcgacgccacggcccgttcggagtactttgttgcccatatgcaggtgctgatggatgaa
agcggcgcgccgcgacggcttcgcgatgtcggtgtaaccgacaacagtctcgccatgctc
gccgcagacgcgatgaaacaaacccgccttctcgtcaacaatccggtcgaagtccgggaa
gaagacgcgcttgccctttatcgggaagccttctga

DBGET integrated database retrieval system