KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL100163Help
Entry
pRL100163         CDS       T00402                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    pRL100163
Enzymes [BR:rle01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     pRL100163
Peptidases [BR:rle01002]
 Cysteine Peptidases
  Family C44
   pRL100163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL10:complement(163707..164786)
Genome map
AA seq 359 aa AA seqDB search
MAEPPMYPPYPNISIKILDHPLLESFRWDTSDQIILICRERSAEANGHLVALRDWPIERA
QDFCAFGQWPLDYQTISINRHSGTVTFSAGHGGVAPLYLKVSGERIELSWSIADFYSGMT
LPDVDTDRTGLRLVGTLPYATTTMFRCVFMLTERASLCISRTGAIETKYPPPAPYFIPTP
LVDEADVAAAACRLIDTLLRRWPLTPALTASEFSGGLDSAVVAAILAGQHPDALQTYALE
VEGPARSQQTSRREIAIEHFGFHDQTLRVDTVPMVPCGFEVSSDYVPAPYNADLQRPLHQ
LLKSLATASAPRAVATGTGGDELLMAHAFEQNHEQFARNISDAFLPAILPSAMTLVLKN
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaacccccgatgtacccgccctaccccaacatctctatcaagatcctagaccat
cctttgctcgaaagcttccggtgggacaccagtgatcaaatcatcctgatctgccgcgag
cgttctgccgaagcgaatgggcaccttgtggcactcagggattggccgatagaacgagcg
caggatttctgtgcttttgggcaatggccattggactatcagacaatttcgatcaatcgc
cattccggcacggtgaccttcagcgccggacatggaggtgttgcgccactttatctgaag
gtcagcggcgagcgcatcgagctctcctggtcgatagcggacttttattcgggcatgact
ctccccgacgtcgacacggatcgaaccggcctgcgtcttgtggggacgctcccctatgca
acaaccacgatgtttcgctgtgttttcatgctgacggagcgcgcgtcactttgcatcagc
aggacgggagccatcgagacgaaatatccccctccggcaccgtatttcatcccgactccg
cttgtggatgaggccgatgttgcagccgcagcatgccgtttgatcgacaccctgctgcgt
cgctggcccctcacgccggccctcacggctagcgaattcagcggaggattggattcggca
gtcgttgccgccattttggcggggcagcatcctgacgccctgcaaacctatgccttggag
gtcgaggggccagctcgaagtcaacagacttcgcggcgcgaaatagcaatcgagcacttt
ggcttccacgaccaaacgctgcgtgttgacacggtaccaatggttccgtgtgggttcgag
gtgagtagcgactacgtccccgcgccctacaatgccgatctgcagcggcctctccatcaa
ctattgaagtcgctcgcaactgcctcagccccacgggcggtcgcaactggtacaggcggt
gatgaattgctaatggcccatgctttcgagcaaaatcacgagcaattcgctcgtaatatt
agcgatgcattccttcctgcgatccttccctccgccatgacactggtactcaaaaactga

DBGET integrated database retrieval system