KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL100377Help
Entry
pRL100377         CDS       T00402                                 

Definition
acyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rle01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rle00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rle00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:rle00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:rle00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL10:389101..391155
Genome map
AA seq 684 aa AA seqDB search
MTPRPLDRLLRPQTIAVFGGREARRVIEQCDRMGFAGEIWPVHPKLDEVLGRPCYRSVSD
LPSAPDAAFVGVNRMLTVEIVRSLSEAGAGGAVCYASGFSEATGELGDGAELQQALLQAA
GDMPILGPNCYGLINGLDGALLWPDQHGMQRIERGVAILTQSSNIAINLTMQTRGVPIAY
VVTAGNQAQTSLADVACALIDDPRVTAVGLHVEGFGDLSALERLATMARRSRKPVVVLKV
GRSEQAKRAAVSHTASLAGSDAVADAVLARLGLGRVQTLPALLETLKLLHVAGPLASHSI
SSMSCSGGEASLMADAAVGRNVEFAALQPQQLPRLRRVLGEMVTLSNPLDYHTFVWGDLA
RQIEAFSAMFEGGYALNLVVLDFPRGDRCDASEWAMTADAVMTAAAATGALAGLLATLPE
NMPEPIADRLMANGIVAFCGIDETIVAAEVAAGIGRAWDRPAPLPLLDVSPMDGEIETLT
EADAKAELAAFGLPIPRGLLASSPGQAAEQAERLGFPVVLKALGIAHKTEAGAVALNLED
IKAVSNAAAAMPPNAGYLVEKMIDPPVAELIVGAIRDPVFGLSLTLGAGGIFVELLEDSI
ILPLPATKTDIRAAISRLKLAKLIGGYRGRPKGDLEAAVGVVSATADYVVKNAACLEELD
INPLMVLPEGRGVAVVDALIRRRR
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgacgcctcgcccgctcgaccgcctgctcagaccgcaaacgatcgccgtcttcggcggc
cgtgaggcgcgcagggtgatcgagcaatgcgaccgcatgggttttgccggtgagatctgg
cctgttcatccgaagctcgacgaggtgctggggcggccctgttatcgctccgtatccgac
ctgccttcggctccggacgccgccttcgtcggcgtcaataggatgctgaccgtcgagatc
gtccgtagcctttctgaggccggtgccggcggtgcagtttgttatgcatcgggtttcagc
gaggcgacgggtgaactcggcgacggtgccgaactgcagcaggcccttttgcaggcggcc
ggcgacatgccgatcctcgggccgaattgctacggactgatcaacggtctcgacggtgcg
ctgctgtggcccgatcagcatggcatgcagcgtatcgaacgtggcgtcgcgatcctcaca
caatcctccaatatcgccatcaacctgaccatgcagacccgcggcgtgccgatcgcctat
gtcgtcaccgccggcaatcaggcgcagacatcgctcgccgatgtcgcctgcgcactgatc
gacgacccgcgtgtcacggcggtcggccttcatgtcgaaggtttcggcgatctctctgca
ctcgaacgcctggccaccatggcccgacggtcgaggaagccggtcgtcgtgctgaaggtc
ggcaggtccgagcaggcaaaacgcgcggcggtgtcgcataccgcctcgcttgccggcagc
gatgccgtcgcggatgccgtgctcgcccgcctcggcctcggccgcgtccagactctgccg
gcgctcttggaaaccctgaagctgctgcatgtcgccgggccgctcgcaagccattcgatc
tcgtcgatgagctgttccggaggcgaggcgtcgctgatggcggatgccgccgtcggtcgc
aacgtggaattcgcagccctgcagccgcaacaattgccccggctgcggcgggtcctcggc
gagatggtgacgctgtccaatccgctcgattaccacaccttcgtctggggggatctcgca
cgccagatcgaagccttcagcgccatgttcgagggcggctatgccctcaatctcgtcgtc
ctcgattttccgcgcggtgaccgctgcgatgcgtccgaatgggcgatgacggcagacgcg
gtcatgacggctgccgccgcaaccggtgcgctggccggccttctggcgacccttccggaa
aacatgccggagcccatcgccgatcggctgatggcaaacggcatcgttgccttctgcggc
atcgacgaaaccatcgtcgcggcggaagtcgccgccggcatcggccgggcgtgggatcgc
ccggctcccctgccgctgctcgacgtgtcccctatggacggcgaaatcgagacgttgacg
gaggccgatgcgaaggcggagctggccgctttcggccttccgattccgcgaggcctgttg
gcctcttctcccggtcaagcggccgagcaggccgagcggctcggtttccccgtcgtgctg
aaagcgctcggcattgcgcacaagaccgaggccggggccgtcgcgctcaacctggaggat
attaaggccgtgtcgaatgcggcagcggcaatgccgccgaatgccggttatctcgtcgag
aaaatgattgatccgccggtcgccgagctcattgtcggcgccatccgcgaccctgtcttc
ggattgtcgctcacgcttggagcaggcggaatcttcgttgaattgcttgaagattccatc
atcctgccacttccggcgacgaaaaccgacattcgcgcggcgatttcgcgcctcaaactt
gcaaaattgatcggtggctatcgcgggcggccaaaaggcgatctcgaagccgctgtcggc
gttgtctcagcaacggcagattatgtcgtaaagaacgcggcatgcttggaggaactcgac
attaatccattgatggttcttcccgaagggcgtggcgttgccgtagtcgatgccctgata
cggcgaaggaggtag

DBGET integrated database retrieval system