KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL110242Help
Entry
pRL110242         CDS       T00402                                 

Definition
putative alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rle00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rle00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:rle00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL11:256907..258373
Genome map
AA seq 488 aa AA seqDB search
MSFKIAIIGAGSVGFTKKLFTDILCVPEFRDIEFALTDLSEHNLEMIKAILDRVVKANGL
PTKVTATTDRRQALEGARYIISCVRVGGLEAYADDIRIPLKYGIDQCVGDTICAGGILYG
QRNIPVILDFCKDIREVAEPGAKFLNYANPMAMNTWAAIEYGKVDTVGLCHGVQHGAEQI
AEVLGAKSLSELDYICSGINHQTWFIDLRLNGRRIGKDELIAGFEAHPVYSQQEKLRIDV
LKRFGVYSTESNGHLSEYLPWYRKRPDEITRWIDMSDWIHGETGGYLRHSTETRNWFETE
YPQFLESAAQPIDPAKRSNEHASHILEALETNRVYRGHFNVKNNGVITNLPSDAIIESPG
FVDRFGINMVSGVTLPEACAATCIASINVQRMSVHAAISGDIDLLKLAVLHDPLVGAVST
PEEVWQMVDEMVVAQARWLPQYAHAVPAAKERLSKSKVQTRDWAGAARRNVRSIEELRAE
KAALKQAV
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcaaaatcgctatcatcggtgcgggcagcgtcggtttcaccaagaagctgttc
accgacatattgtgcgttcccgagtttcgcgacatcgaattcgcgctgaccgatctcagc
gaacacaatctcgagatgatcaaggccatcctcgaccgcgtcgttaaggcgaacgggctg
ccgacgaaggtgacggcgacgaccgaccggcgccaggcgctggaaggcgcgcgctacatc
atcagctgcgtccgggtcggcgggctcgaggcctatgccgacgatatcagaatcccgctg
aaatacggcatcgaccagtgcgtcggcgatacgatctgcgccggcggcatcctctatggc
cagcgcaacatcccggtcatcctcgacttctgcaaggatatccgcgaggtcgccgagccc
ggtgcgaaattcctgaactatgccaacccgatggcgatgaacacctgggcggcgatcgaa
tacggcaaggtcgataccgtcggcctctgccacggcgtccagcacggcgccgagcagatc
gccgaggtgctcggcgcaaagtcgctgagcgagctcgactatatctgctccggcatcaac
caccagacctggttcatcgaccttcgcctcaacggccgcaggatcggcaaggatgagctc
atcgccggcttcgaggcgcatccggtctattcgcagcaggagaaattgcgcatcgacgtg
ctgaagcgtttcggcgtctattccaccgaaagcaacggccatctctcggaatacctgccc
tggtatcgcaagcggccggatgaaatcacccgctggatcgacatgtccgactggatccat
ggcgagaccggcggctatctccgccattccaccgaaacgcgcaactggttcgagacggaa
tatccgcaattcctggaatccgccgcgcagccgatcgatcccgccaagcgctcgaacgaa
catgcaagccatatcctcgaggcgctggagacgaaccgggtctatcgcggccatttcaac
gtcaagaacaatggcgtcatcaccaacctgccgtccgatgcgatcatcgaatcgccgggc
ttcgtcgatcgcttcggcatcaacatggtctcgggcgtcaccctgccggaagcttgcgcg
gcgacctgcatcgcctcgatcaacgtccagcgcatgtcggtgcatgcggcgatatcgggc
gacatcgacctcttgaagcttgccgtgctgcacgacccgctggtcggcgccgtctcgacg
ccggaagaggtctggcagatggtcgacgagatggtcgttgcccaggcgcgctggctgccg
caatatgcccatgccgtgccggccgccaaggagcggctgtcgaaatcgaaggtgcagacc
cgcgactgggcgggggccgcacgccgcaacgttcgctcgatcgaggagctgcgcgcggaa
aaggcggcgctgaaacaggccgtctga

DBGET integrated database retrieval system