KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL110247Help
Entry
pRL110247         CDS       T00402                                 

Definition
putative alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    pRL110247
  Lipid metabolism
   00561 Glycerolipid metabolism
    pRL110247
   00600 Sphingolipid metabolism
    pRL110247
Enzymes [BR:rle01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     pRL110247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL11:264608..265978
Genome map
AA seq 456 aa AA seqDB search
MARNPKITFIGAGSTVFMKNIVGDVLQRPALSGATIALMDLNPQRLEESAIVVNKLISTL
GVKAKAETYSDQRKALSGADFVVVAFQIGGYEPCTVTDFEVPKKYGLRQTIADTLGVGGI
MRGLRTVPHLWKVCEDMLVVCPEAIMLQYVNPMAINTWAISEKYPTIRQVGLCHSVQGTA
MELAHDLDIPYDEIRYRAAGINHMAFYLKFEHSQPDGSYRNLYPDLLRAYREGRAPKPGW
NPRCPNKVRYEMLTRLGYFVTESSEHFAEYTPYFIKEGRDDLIEKFGIPLDEYPKRCIEQ
IERWKGQAEAYRSADKIEVAPSKEYASSIINSVWTGEPSVIYGNVRNNGCITSLPTNCAA
EVPCLVDASGIQPTFIGDLPPQLTALIRTNINVQELTVQALMTENREHIYHAAMMDPHTA
AELDLDQIWSLVDDLLATHGDWLPEWARTTRKVQAA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaatcccaagattacgttcatcggagctggctccaccgtcttcatgaagaac
attgtcggcgacgtgctgcagcgtcccgcgctgtcaggcgcgacgatcgccttgatggat
ctcaacccgcagcggctggaagaaagcgccatcgtcgtcaacaagctgatctcgacgctt
ggcgtgaaggcgaaggcggaaacctattccgaccagcgcaaggcgctttcgggcgccgat
ttcgtcgtcgtcgccttccagatcggcggctatgagccctgcacggtcaccgatttcgaa
gtgccgaagaaatacgggctgcgccagacgatcgccgatacgctcggcgtcggcggcatc
atgcgcgggcttcgcaccgtgccgcatctctggaaggtctgcgaggacatgctcgtcgtc
tgcccggaggcgatcatgctgcaatatgtcaacccgatggcgatcaacacctgggcgata
tcagagaaatatccgaccatccgccaggtcggcctctgccactcggtgcagggcacggcg
atggaactggcccacgacctcgacatcccctatgacgaaatccgctaccgggcggccggc
atcaaccacatggccttctatctcaagttcgagcatagccagccggacggttcctaccgc
aacctctatcccgacctgctgcgcgcctatcgcgagggcagggcgccgaagcccggctgg
aacccacgctgcccgaacaaggtgcgctatgagatgctgacgcggctcggctatttcgtc
accgaaagctcggaacatttcgccgaatacacgccctatttcatcaaggagggtcgcgac
gacctgatcgagaaattcggtatcccgctcgacgaatatccgaagcgctgcatcgagcag
atcgagcgctggaagggccaggcagaggcctatcgttcggctgacaagatcgaagtcgcg
ccgtcgaaggaatatgcttcttcgatcatcaattcggtctggaccggcgaaccctcggta
atttacggcaatgtccgcaacaatggctgcatcacctcgctgccgaccaattgcgccgcc
gaagtgccctgcctcgtcgatgcctccggcatccaaccgaccttcatcggcgacctgccg
ccgcagctgaccgcgctgatccgcaccaatatcaacgtccaggaactgacggtgcaggct
ctgatgaccgaaaatcgcgagcatatctatcatgccgcgatgatggacccgcatacggcg
gccgaactcgacctcgaccagatctggtcgctggtcgacgatctgctcgccacccacggc
gactggctgcccgaatgggcacgcacgacccgtaaggtacaggccgcctga

DBGET integrated database retrieval system