KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL110284Help
Entry
pRL110284         CDS       T00402                                 

Definition
putative methylamine utilization protein MauG precursor
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Brite
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     pRL110284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL11:complement(311641..312882)
Genome map
AA seq 413 aa AA seqDB search
MATTALCLALLPLRQSSAATAVGLHPGPMSRTEAFARAEMLTALGRKIFSDPSLSASGLQ
ACASCHDPSHAFSPASAMPVEMGGEHGDQPGLRAVPTLRYLQSVPAFTEHYYDSEDEGDE
SVDNGPTGGLTWDGRVDHGADQAKIPLLSPFEMGNKDAAEVVAKLRKAAYADDIKAAFGA
TVFDNPKDAFDAAAEALATFEQSGPDFYPYSSRYDAFLAGKATLTAQELHGRQLFEDPAK
GNCSSCHLSEPANDGEPPQFSDFGFLGLAAPRNMAIPANSDPNYHDLGLCGPQRTDFAGR
SEYCGLFRTPTLRNVSLKKSFFHNGYFHSLRDVVSFYATRDSDPGRWYPKNSDGTVRRYD
DLPQAYWDNLNQDPPFGRKPGDAPALTDPEIDDIVAFLGTLTDADLQSDATGH
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaacggcgctctgtcttgcccttcttcccctgcggcaaagcagcgcggcgacc
gccgtcggcctacatccaggaccgatgtcgcgcacggaagccttcgcccgggcagaaatg
ctcaccgcgctcggccgcaagatattctcagatccctcgctgtcggcctcggggcttcaa
gcctgcgcgtcctgccatgatcccagtcatgccttcagcccggcatcggccatgccggtc
gagatgggcggcgaacatggggaccagccgggcctgcgcgccgttccgacgctgcgctat
ctgcaatcggtgcctgctttcaccgagcattattacgattccgaggacgagggcgacgaa
agcgtcgacaatggcccgacgggcggcctgacttgggacggccgggtcgatcacggcgcc
gatcaggcgaagatcccgctgctctcgcccttcgagatgggcaacaaggatgcggccgag
gtggtggcgaagctgcgaaaagccgcctatgccgacgacatcaaggcagccttcggcgcc
accgtgttcgacaatcctaaggacgccttcgatgccgctgccgaggcgctcgccaccttc
gaacagagcggcccggatttctatccctattccagccgctacgacgcctttctcgccggc
aaggcgacgctgacagcgcaggagttgcacggacggcaactgttcgaggaccccgccaag
ggcaactgctcaagctgtcacttaagcgaacccgccaatgacggcgagccgccgcaattt
tcagatttcggcttcctcgggcttgccgcaccgcgcaacatggcgatcccggccaacagt
gatcccaactatcatgatctcggtctttgcggcccgcagcgtaccgactttgccggacgc
agcgaatattgcggcctgttccgcaccccgacgctgcgcaatgtctcgctgaagaagagc
ttcttccacaatggctatttccactcgctgcgcgacgtcgtctccttctacgcgacgcgc
gacagcgatcccggccgctggtatccgaaaaactcagacggcacggtccgtagatatgac
gacctgccgcaggcctattgggacaatctcaaccaggacccgcccttcggcaggaagccg
ggcgatgcgcccgccctcaccgatcccgagatcgacgacatcgtcgctttcctcggaacc
ctgaccgatgccgacctgcaatctgatgcgaccgggcattga

  All links  
No link information was found.   
DBGET integrated database retrieval system