KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL110511Help
Entry
pRL110511         CDS       T00402                                 

Definition
putative glycosyl hydrolase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    pRL110511
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    pRL110511
Enzymes [BR:rle01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     pRL110511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL11:complement(551717..553744)
Genome map
AA seq 675 aa AA seqDB search
MTMSTSRPKTLRLETLWNPPADGKEFSYVLRLKNLGTEPLSNFSLCVSGPGRVDPAGRVE
GATVSQRLSNFTEFQPPANFILGAGETWTISVYALSWQFRHWTDGATSGYLALADGSTIV
LTIEPTRSSVSNAPLKRGAEIYPVPVNAPVQVSIIPWPNHVAVASRRPLPAGFAPQAQSA
AGEAAARGFAALVEHLFAVEGIVRSEAEGAVPVALKDAAGLGPEAYRLSFEDETITIEAS
SQTGFLYGLVTLGQIWRGARLHPEVFQFPASGEIVDEPSMGWRGLHLDVARQFYGAAEVK
KLLAVLAWNKLNRFHWHLSDDEAWRVEIDAYPDLTAVGAWRGHGLAVPPLLGSSPARTGG
YYTKAAIREIVAHAKSFGVEIVPEIDVPGHCYAMLQAIPELRDPAEVGSYYSVQGFPDNC
INPAREKTYEIIETILLELIELFPFKTIHLGADEVPLGAWSGSPEALERLRSVAGDEVAD
AHAKRLNVVTNTHGADDIHGSGAAILQAEFLNRVQRFLASKGCITGGWEEAAHGDVIDKS
KSYLCSWRNVEVSAELAERGYEIVVCPGQVYYLDMALRPDWDEPGASWAGTSDAEKLYNF
DPIGGWTASQKQKLLGIQACIWSEPMTDRAVFDRLVFPRLSALAETGWTKPSSKSWERFR
ALAGLMPLLYGLQQS
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatgtccacatcacgaccgaaaaccctgcggcttgaaaccctttggaatccgcct
gctgacggtaaggagttttcctacgtcctgcgcctcaagaacctcggcaccgagccgctt
tcgaatttctccctctgcgtgagcggcccgggccgcgtcgatccggccgggcgcgtcgaa
ggcgccacggtttcgcagcggctgtcgaatttcaccgaattccagccaccggccaatttc
attctcggcgccggtgagacgtggacgatatcggtctacgcgctgagctggcagttccgc
cactggacggacggcgcgacgagcggttatctcgctctggccgatggcagcacgatcgtg
ctcaccatagagccgacgcgatcttcggtcagcaacgcgccattgaagcgtggcgccgag
atctatccggtgcccgtcaatgcgcccgttcaggtgtcgatcatcccttggccgaaccat
gtggcggtcgcctcgcgccggccgctgccggccggttttgcgccgcaggcgcagagcgct
gcaggggaggcggcagcacgcggcttcgcagcactggtcgagcatctcttcgccgtcgaa
ggcatcgtgcggagcgaggcggaaggcgcagttcccgttgccctgaaggatgccgccggg
ctcgggccggaggcctatcgcctgagcttcgaggatgagacgatcacgatcgaggcaagc
agccagaccggcttcctctacggccttgtcacactcggccagatctggcgcggtgcaagg
ctgcatcccgaggttttccagtttccggcctccggcgagatcgtcgatgagccgtcgatg
ggctggcgcggcctgcatcttgacgtcgcccgccagttctacggtgcggccgaggtcaag
aagctgctggcagtgcttgcctggaacaagctcaaccgcttccactggcacctttccgac
gacgaagcctggcgcgtcgagatcgacgcctatcctgatttgaccgcggtcggtgcctgg
cgcggccacggcctggccgttccgccgctgctcggttcgagcccagcccgcaccggcggt
tactacaccaaggctgccatccgcgagatcgtcgcccatgccaagagcttcggcgttgag
atcgtgccggagatcgatgtccccggccattgctacgccatgctgcaggcgataccggag
ttgcgcgatccggccgaggtcggcagctattattcggttcagggctttccggacaattgc
atcaatccggcccgcgagaagacctatgagatcatcgagacgatcctcttggaactcatc
gagctctttccgttcaagaccatccatctcggcgccgacgaagttccgctcggcgcgtgg
tccggctcgccggaagcgctcgagcgcctgcgcagcgtggcgggcgacgaggttgccgat
gcgcatgccaagcggctgaacgtcgtgaccaatacccacggcgccgacgacatccacggc
tcgggtgccgccatcctgcaggcggagttcctgaaccgcgtccagcgcttccttgcgagc
aagggctgcatcaccggcggctgggaagaggctgcccatggcgatgtcatcgacaaatcg
aagagctatctctgcagctggcgcaatgtcgaggtctcggccgaacttgccgagcgcggc
tacgaaatcgtcgtctgccccggacaggtctattacctcgacatggcgctgcggcccgac
tgggatgagcccggcgccagctgggccggcacctcggatgccgagaaactctacaatttc
gaccccatcggcggctggacggcgagccagaaacagaaactcctcggcatccaggcctgc
atctggtccgagccgatgacggatcgcgccgttttcgaccgcctcgtctttccgcgcctt
tccgcgcttgctgaaacgggctggacgaagccgtcatccaagtcgtgggagcgcttcagg
gcgctcgcaggactgatgccgctgctctacggtctacagcaatcgtag

DBGET integrated database retrieval system