KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120034Help
Entry
pRL120034         CDS       T00402                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    pRL120034
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    pRL120034
   00052 Galactose metabolism
    pRL120034
   00500 Starch and sucrose metabolism
    pRL120034
   00520 Amino sugar and nucleotide sugar metabolism
    pRL120034
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    pRL120034
   00524 Butirosin and neomycin biosynthesis
    pRL120034
Enzymes [BR:rle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     pRL120034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL12:32716..33681
Genome map
AA seq 321 aa AA seqDB search
MQQVAIGIDLGGTQVRAALVDEQGRILARAAEPTDALAGPDRVLAQICGLTDGLLAASNP
ASVVGVGVSAPGPLDTVAGVASNIPTLSGFVDFPLKAELQKRFPFPVDLENDAIAAAIGE
WQFGAGKGLDNLVYVTVSTGIGGGVVSDGRVVRGRKGMAAHVGHMSVVPNGELCPCGNRG
CFEAYGSGTAFARRAQMRAMETSGTTIGSDGGAIDSRGVFAAARDGDRLANQLVDEEAEI
LGRGFTSLIHIFSPDIIVMGGGLSHEFDRLQPGIQAYITQWAMPAFRDVKVVLAALDQNS
GLVGAAALAFLTGKVPAIDQL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaggttgccattggaatcgacctcggcgggacgcaggtgcgcgctgccctcgtc
gacgagcagggcaggatccttgcccgcgcagccgaaccgacggatgcgctggcaggcccc
gaccgggtgctcgcccaaatctgcggcctgaccgatggactgcttgcagcatcaaatcct
gcttcggtggtgggcgtcggcgtatccgctccaggcccgctcgatacggtcgccggtgtc
gcctcgaatatcccgaccctctccggctttgtcgactttccgctgaaggcggagttgcag
aagcggtttccgtttccggtcgacctcgagaatgatgcaatagccgctgccatcggcgag
tggcagttcggagccggcaagggcctggataatctggtctatgtcaccgtgagcaccggc
attggcggtggcgttgtgtcggatggtcgcgtcgtgcgcggccgcaagggcatggcagcc
catgtcgggcacatgtcggtcgtgccgaacggagagctttgtccctgcggcaaccggggt
tgtttcgaggcctacggatccggaacggcttttgcgcgccgcgcccaaatgagggcgatg
gaaaccagcgggacgacgatcggcagcgacggcggcgccattgacagccgcggcgttttc
gcggccgcaagggatggcgatcgtcttgcaaatcaactggttgacgaggaagcggaaatt
ctcggtcgcggcttcaccagcctgatccatatcttcagtccggatatcatcgtgatggga
ggcgggctttcccacgagttcgatcgtctacaacccggcattcaagcctacatcacgcaa
tgggcaatgccggcattcagggatgtcaaagtggtgctggcggcgttggatcagaactcg
ggcctcgtcggcgccgcggctctggcgtttctgaccggcaaggtccctgcgatcgatcag
ctttag

DBGET integrated database retrieval system