KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120042Help
Entry
pRL120042         CDS       T00402                                 

Definition
(GenBank) putative alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00010  Glycolysis / Gluconeogenesis
rle00071  Fatty acid degradation
rle00350  Tyrosine metabolism
rle00625  Chloroalkane and chloroalkene degradation
rle00626  Naphthalene degradation
rle01100  Metabolic pathways
rle01110  Biosynthesis of secondary metabolites
rle01120  Microbial metabolism in diverse environments
rle01130  Biosynthesis of antibiotics
rle01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    pRL120042
  Lipid metabolism
   00071 Fatty acid degradation
    pRL120042
  Amino acid metabolism
   00350 Tyrosine metabolism
    pRL120042
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    pRL120042
   00626 Naphthalene degradation
    pRL120042
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     pRL120042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N DapB_N
Motif
Other DBs
NCBI-ProteinID: CAK11756
GeneDB: pRL120042
RhizoBase: pRL120042
UniProt: Q1M561
Position
pRL12:complement(40981..42054)
Genome map
AA seq 357 aa AA seqDB search
MTIPEKMAAVLLTGHGGLDKLVYDREVPVPRPADGEVLIRVTACGMNNTDVWVRQGAYGT
EDDPSAVSTWRRQGNTLTFPRIQGTDTVGHIVGVGAGVNPARIGERVMVDFSIYNRDDDS
LADIDYMGHGRDGGYAEYMALPAENAHVVATDLTDVELATFCCAYLTGERMLERARLVAG
ERVLVTGASGGVGSAIIQLARARSAIPIAVAGPGKEAAMFDIGAEAVVTRGKGDLVEAAH
SASRGQPIDVVADLVGGPLFNDLLKILRPEGRYTTAGAIAGPVVQLDLRTMYLKQLELHG
SSQGSRADFRRIVGYIESRKIRPLVGGVYPLSEFHRAQTDFMAKNFVGKLVVVPDET
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcccggaaaagatggcggcggtattgctcaccggccatggcgggttggacaag
ctcgtctatgacagggaggtgcccgtcccgagacctgcggacggcgaggtgctgatccgc
gtcacggcctgcggcatgaacaataccgacgtctgggtccgccaaggcgcctacggcacc
gaggacgatccgtctgccgtctccacatggcgcaggcaaggcaatacactgacattccca
cgcatccagggcaccgatacggtcggccatattgtcggcgtcggcgccggcgttaatccg
gcgcgcatcggcgagcgcgtcatggtcgacttctcaatctacaaccgggacgacgacagc
ctcgccgacatcgattacatgggccatggccgcgacggcggttatgccgaatacatggca
ctgccggccgagaacgcccatgtcgtcgcaaccgatctgaccgacgtcgaactcgccacc
ttctgctgcgcctatctgaccggcgagcgtatgctggaacgggcaaggcttgtcgccggt
gaacgcgtcctggtgaccggcgcctcgggtggcgtcggctcggcgatcatccagctcgca
cgtgcccgcagcgccatcccgatcgcggtcgccggccccggcaaggaggcggcgatgttc
gatatcggcgccgaagcagtcgtgacccgcggcaagggcgatctcgtcgaagccgcccat
tccgccagccgtggccagccgatcgatgtcgtcgccgatctcgtcggcggaccgctgttc
aacgatctcctgaagatcctgcgccccgaaggccgctacacgacagccggcgccatcgcc
ggcccggtcgttcagctcgatttgcggaccatgtacctgaagcagttggaactgcacgga
tcgagccagggaagccgcgccgacttccgccggatcgtcggctatatcgaaagccggaaa
atccggcctctcgtcggcggcgtctatccgctgtcggaattccaccgcgcgcagaccgat
ttcatggcgaagaacttcgtgggcaaattggtcgtcgttcccgacgagacatga

DBGET integrated database retrieval system