KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120182Help
Entry
pRL120182         CDS       T00402                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    pRL120182
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    pRL120182
  Lipid metabolism
   00071 Fatty acid degradation
    pRL120182
  Amino acid metabolism
   00350 Tyrosine metabolism
    pRL120182
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    pRL120182
   00626 Naphthalene degradation
    pRL120182
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     pRL120182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL12:186783..187778
Genome map
AA seq 331 aa AA seqDB search
MTETFTAMVIDTVDGKPKGAFRQLSIADLPDNDVLVEIAYSTLNYKDGLAISGKGRIARR
MPMVGGIDLSGTVIESRSLEWKPGDKVVLNGWGLSETEWGAYGRYQRVKSEWLIPLPEAF
SLQQAMAIGTAGYTAALCVDALEKWGSIKPGEGEVLVTGAAGGVGSVAIALLAARGYNVT
ASTGRPETHDYLAFLGATTFIDRATLAEKGGPLQRERWTGGIDSVGSTTLANALSQTVHG
CAIACCGLAGGADLPATVLPHILRAVTLIGIDSVIATRQQRLSAWARLARDMDKGKLDSM
TTVEPMSKLPQLAEDIVAGKIRGRAVIDVNG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaccttcaccgcaatggtgatcgacaccgttgacggcaagccgaaaggtgcg
ttcaggcaactctcgatcgccgatctgccggacaatgacgtgctggtcgaaatcgcctat
tcgacgctcaactacaaggacggcctcgcgatctccggtaagggccgcatcgctcgccgc
atgccgatggtcggcggcatcgatctctccggcaccgtgatcgaatcccgatcgctggaa
tggaagccgggcgacaaggtggtgctgaacggctggggcctttcggagaccgaatggggc
gcctatggccgttaccagcgcgtcaagtcggagtggctgatccccctgcccgaggccttc
tcgttgcaacaggcgatggcgatcggcaccgccggttacaccgccgcgctctgcgtcgat
gcccttgaaaaatggggttcgatcaagccgggcgaaggcgaagtcctggtcaccggtgcg
gccggcggcgtcggttcggtggctatcgccctgcttgccgcgcgcggctacaacgtcacg
gcgtccacgggccgtccggagacccatgattatctcgcctttctgggcgccaccaccttc
atcgaccgcgcgacgcttgccgaaaagggtggcccgttacaaagggaacgctggaccggc
ggtatcgacagtgttggttcgacgacgctcgccaatgcactgtcccagacggttcacggc
tgcgcaatcgcctgctgcggcctcgccggcggtgccgatcttccggccactgtgctgccg
catatcctgcgtgccgtaaccttgattggcatcgattccgtgatcgccacccgccaacag
cggctttccgcatgggcgcggcttgcccgcgatatggacaagggcaagctcgacagcatg
acgactgttgagcctatgtccaagctgccacaactcgctgaagacattgtcgcgggcaaa
attcgcggccgggccgtcatcgatgtgaatggttaa

DBGET integrated database retrieval system