KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120209Help
Entry
pRL120209         CDS       T00402                                 

Gene name
tpiA2
Definition
(GenBank) Triose phosphate isomerase, required for erythritol catabolism
  KO
K21910  
L-erythrulose 1-phosphate isomerase [EC:5.3.1.33]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Brite
Enzymes [BR:rle01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.33  L-erythrulose 1-phosphate isomerase
     pRL120209 (tpiA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL12:219214..219984
Genome map
AA seq 256 aa AA seqDB search
MTEKPRFWIGTSWKMNKTLTEAEQFARGLEAADGARDPRIHRFVIPPFTAVREVKAMLAK
TSVKVGAQNMHWADQGAWTGEVSPVMLKDCNLDLVELGHSERREHFGETDETVGLKTEAA
VRHGLIPLICIGETLSDRESGKAADILATQVRGALSKLSGAQKSAEILLAYEPVWAIGEK
GIPATADYADARQSEIIAVAEAVLGRKIPCLYGGSVNPQNCEELISSPHIDGLFIGRSAW
NVEGYLDILARCAAKL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaaagccgcgcttctggattggcaccagctggaagatgaacaagacgcttact
gaagccgagcaattcgcgcgcggtctcgaagccgccgatggcgcgcgtgacccgcgcatc
catcgcttcgtgattccacccttcacggccgtgcgcgaggtcaaggcgatgcttgccaag
acctcggtgaaggtcggcgcgcagaacatgcattgggccgaccagggcgcctggaccggc
gaagtctcgccggtgatgctgaaggactgcaatctcgatctcgtcgagctcggccattcc
gaacggcgcgaacattttggagagaccgacgagacagtgggtctgaagaccgaagcagcc
gttcgccacggcctcattccgctgatctgcattggcgagacgctttccgaccgcgaaagc
ggaaaggccgccgacatcctcgcgacccaggtgcgcggcgcgctatcgaaactttcgggc
gcccagaaaagcgccgaaatcctgctcgcctacgagcccgtctgggcgattggcgagaag
ggcatcccggcgactgcggattatgccgatgcccgccagtctgaaatcatcgccgttgcc
gaagctgtgctgggccggaagatcccctgcctctatggcgggtcggtcaacccgcagaac
tgcgaagaactgatctcaagcccgcatatcgacgggctcttcatcggccgttcggcctgg
aatgtcgaaggctacctcgacatcctggccagatgcgccgccaaactttaa

DBGET integrated database retrieval system