KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120209Help
Entry
pRL120209         CDS       T00402                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    pRL120209 (tpiA)
   01230 Biosynthesis of amino acids
    pRL120209 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    pRL120209 (tpiA)
   00051 Fructose and mannose metabolism
    pRL120209 (tpiA)
   00562 Inositol phosphate metabolism
    pRL120209 (tpiA)
Enzymes [BR:rle01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     pRL120209 (tpiA)
Exosome [BR:rle04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   pRL120209 (tpiA)
  Exosomal proteins of bladder cancer cells
   pRL120209 (tpiA)
  Exosomal proteins of melanoma cells
   pRL120209 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL12:219214..219984
Genome map
AA seq 256 aa AA seqDB search
MTEKPRFWIGTSWKMNKTLTEAEQFARGLEAADGARDPRIHRFVIPPFTAVREVKAMLAK
TSVKVGAQNMHWADQGAWTGEVSPVMLKDCNLDLVELGHSERREHFGETDETVGLKTEAA
VRHGLIPLICIGETLSDRESGKAADILATQVRGALSKLSGAQKSAEILLAYEPVWAIGEK
GIPATADYADARQSEIIAVAEAVLGRKIPCLYGGSVNPQNCEELISSPHIDGLFIGRSAW
NVEGYLDILARCAAKL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaaagccgcgcttctggattggcaccagctggaagatgaacaagacgcttact
gaagccgagcaattcgcgcgcggtctcgaagccgccgatggcgcgcgtgacccgcgcatc
catcgcttcgtgattccacccttcacggccgtgcgcgaggtcaaggcgatgcttgccaag
acctcggtgaaggtcggcgcgcagaacatgcattgggccgaccagggcgcctggaccggc
gaagtctcgccggtgatgctgaaggactgcaatctcgatctcgtcgagctcggccattcc
gaacggcgcgaacattttggagagaccgacgagacagtgggtctgaagaccgaagcagcc
gttcgccacggcctcattccgctgatctgcattggcgagacgctttccgaccgcgaaagc
ggaaaggccgccgacatcctcgcgacccaggtgcgcggcgcgctatcgaaactttcgggc
gcccagaaaagcgccgaaatcctgctcgcctacgagcccgtctgggcgattggcgagaag
ggcatcccggcgactgcggattatgccgatgcccgccagtctgaaatcatcgccgttgcc
gaagctgtgctgggccggaagatcccctgcctctatggcgggtcggtcaacccgcagaac
tgcgaagaactgatctcaagcccgcatatcgacgggctcttcatcggccgttcggcctgg
aatgtcgaaggctacctcgacatcctggccagatgcgccgccaaactttaa

DBGET integrated database retrieval system