KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120378Help
Entry
pRL120378         CDS       T00402                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Brite
Enzymes [BR:rle01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     pRL120378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL12:complement(408099..409010)
Genome map
AA seq 303 aa AA seqDB search
MPGDLPMPTTMFTADELAVIRRAYAHQVMATAATTNPRIEAAFATVPREKFLGAPPWQIA
NLGGGNRPLPSSDLVLAYQDVLFALQPDNGVNNGSPSLHARLLAELDIQIGDRIAHIGAG
TGYYSAILAELVGTSGHVYAVEMDPDLAAHAQAALAERANVSVINADGSQWPQQEVDAIY
VNFAVARPAEPWIERLRPGGRLVLPLGVPRQDRPPKGGRHASHGAALRIEHGEGGFAARW
IGTAYFVCANGGLTIDDNEIEALTAAFRRGGIEFVKSLLWKTEPRIGRCWHIGGQWALCY
DDV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcccggagatttgcccatgccgactacgatgttcacggccgacgaactggcggtgatc
cgccgcgcttacgcgcatcaggtgatggcaaccgccgcaacgacgaacccgcggatcgaa
gctgcctttgccaccgtcccgcgcgaaaaattcctcggcgcgccaccatggcagatcgcc
aatctgggcggcggaaatcgccccctcccctcctccgacttggttctggcctatcaggac
gtgctattcgccctgcagcccgacaacggtgtcaacaatggtagcccctcactgcatgcc
cggctcctggcagaactggacatacaaatcggcgatcgcatcgcccatatcggtgccggc
accggttattacagcgcaattctcgcagagttggtcggcacttctggtcatgtctatgcc
gtcgagatggatcccgatctggcggcccacgcgcaagcagcgcttgccgagcgcgccaat
gttagcgtcatcaacgccgacggtagtcaatggccgcagcaagaggtggatgcgatctat
gtgaatttcgccgtcgcgcggcccgcggaaccctggatcgaaaggctgcggcctggaggg
cgtctggtgctgccactcggcgtaccgcgccaggaccgaccgccgaaaggcggccgtcat
gcgtcccatggtgctgcacttcgtatcgagcacggcgagggtggatttgcggcgcgttgg
atcggcacagcctatttcgtctgcgccaacggtgggttgacgatcgacgataacgagatc
gaggcgctgaccgccgccttcaggcgcggcggcatcgagttcgtcaaaagcctgctctgg
aagacggagccgcggatagggcgctgctggcatatcggcggccaatgggcgctctgctat
gacgacgtctga

DBGET integrated database retrieval system