KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120392Help
Entry
pRL120392         CDS       T00402                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2291
Motif
Other DBs
NCBI-ProteinID: CAK12101
GeneDB: pRL120392
RhizoBase: pRL120392
UniProt: Q1M471
Position
pRL12:complement(424866..425510)
Genome map
AA seq 214 aa AA seqDB search
MLRMKGALLAAVVAAALPGCKIIKTPTAEEKAAAAAKTAFDPNAKVEAIWQSEAVPYFEK
RAGDLKDVMQLAASSPDAAGEKYGNPRKQSSSPWTYAVKITGKVVAADTASRAATLDIDA
DGDGKADAKVQIGPALRGTALRDTLEFVNFNEFKNQIEWAQFGKAFNEKANTAFLSAIPR
EGLAGKTVTAIGAFPLPKSGELPLITPSELKVGP
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgttgagaatgaagggcgccctgctcgctgccgtcgtggcggccgccttgcccggttgc
aagatcatcaagacgccgacggctgaggaaaaggcggcggcagcggccaagaccgccttc
gacccgaatgcaaaggtcgaggcgatctggcagtccgaggcagtgccctatttcgaaaag
cgcgccggcgacctcaaggacgtcatgcaactggcagcctccagccccgacgccgcaggc
gagaaatacggcaacccccgcaagcagagcagctcgccatggacctatgcggtgaagatc
accggcaaggttgttgcggccgatacggcctcgcgcgcggcgacgctcgatatcgacgcc
gatggcgacggcaaggccgacgccaaggtgcagatcgggccggcgctgcgcggcacggcg
ctgcgcgacacgctggagttcgtcaatttcaacgaattcaagaaccagatcgagtgggcg
cagttcggcaaagccttcaacgagaaggccaatacggcctttctctccgccattccgcgt
gagggcctcgccggcaagacggtgaccgcgatcggcgcctttccgctgccgaagagcggc
gagctgccgctcataacaccttcggaactgaaggtcggcccatga

DBGET integrated database retrieval system