KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120394Help
Entry
pRL120394         CDS       T00402                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL12:complement(426601..427428)
Genome map
AA seq 275 aa AA seqDB search
MTKIALFGAGGKMGYRLAKNLKGSRFEVRHVEVSDAGKARLKNDLGVDCVPVDAGLDGAE
VVILAVPDTAIGKVAAGIVDKLAAGTMVIALDAAAPFAGHLPKRDDLTYFVTHPCHPPIF
NDETEMQAKKDHFGGLFAKQHIVSALMQGPESAYALGEEIAKLIWAPVMRSHRVTVDQLA
MLEPGLSETVCASLLVVMRQAMDECVARGVPEQAARDFLLGHMNVLGAVIFKEVEGVFSD
ACNKAIEFGIPALMRDDWKKVFEPQEIAESIRRIT
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgactaagattgccctcttcggcgcaggcggaaaaatgggataccggctcgccaaaaat
ctcaaaggctcgcgtttcgaggtccgccatgtcgaggtgagcgacgcaggcaaggcccgt
ttgaagaacgatctcggtgtcgattgcgtccctgtcgatgccgggctcgacggcgctgag
gtggtgatccttgccgtgccggacacggcgatcggcaaagtcgcggcaggcatcgtcgac
aagctcgcagcaggtaccatggtgatcgcgctggacgctgcggctccctttgccggccac
ctgccgaagcgtgatgatcttacctatttcgtcacccatccctgccatccgccgatcttc
aacgacgagacggagatgcaggcgaaaaaggaccacttcggcggcctcttcgccaagcag
catatcgtttcggcgctgatgcagggtccggaaagcgcctatgcgctcggcgaggaaatc
gccaagctgatctgggccccggtcatgcgctcgcacagggtcacggtcgatcagcttgcc
atgctcgaaccgggtttgtcggaaaccgtctgcgcatcgctgctcgtcgtcatgcgacag
gccatggacgaatgcgtggcacgcggcgtgccggaacaggccgcccgcgacttcctgctc
ggccatatgaacgtactcggcgcggtcatcttcaaggaagtcgagggcgtgttttcggat
gcctgcaacaaggcgatcgagttcggcatcccggcgctgatgcgcgacgactggaaaaaa
gtattcgaaccgcaggagatcgccgaaagcatccggcgcatcacctga

DBGET integrated database retrieval system