KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120397Help
Entry
pRL120397         CDS       T00402                                 

Definition
(GenBank) putative GntR family transcriptional regulator
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL12:430285..431043
Genome map
AA seq 252 aa AA seqDB search
MFSTRKLLGENILSQRDVMTQPLEQIVRRKLSDEVFDRLERMITSGELQPGDEMPSERVL
MERFGVGRPAIREAMQSLANKGLVSISHGERAKVLRLTAKSIFRQVDLTAKIMLSQSSDS
LEYLKSARIFFERGMAREAAQRASANDIADLRNVIERQRMSLGRAEEFIDADMEFHTRIA
QISGNPIYVAVSEAMLAWLKEYHTEMLIWTGKEKFTLAEHDEIVDRLEANDVDGSETALL
KHLERSRALYAK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
ttgttctcgacacggaaactgttaggagaaaacattttgagccagcgagatgtgatgacc
caacccctcgaacaaatcgtccgccggaaactctctgacgaagtgtttgatcgacttgag
cgaatgatcacctcgggcgagcttcagcccggcgacgaaatgccgtccgagcgggtgctg
atggaacgcttcggcgtcggccggccggcgatcagggaggcgatgcagtcccttgccaat
aaaggtcttgtcagcatttcgcatggcgagcgggcgaaggtcctcaggctgacggcaaag
tcgatattccgtcaggtcgatctcaccgccaagatcatgctgtcgcaatcgtcggactcg
ttggaatatctgaagagcgcgcgcatcttcttcgagcggggcatggcgcgcgaggcggcg
cagcgggcctccgcaaatgatatcgctgacctcaggaatgtcatcgaacgccagcgcatg
tcgcttggccgggcagaagagttcatcgacgcggacatggaattccacacccgcatcgcg
cagatatcaggcaacccgatctacgtcgccgtcagcgaagcaatgcttgcctggctgaag
gaatatcataccgagatgctgatctggaccggcaaggaaaaattcacgctcgccgaacac
gacgagatcgtcgaccgccttgaagcaaacgacgtggatggctcggaaacggcactcctc
aagcatctcgagcggtcgcgagcgctttacgcgaagtaa

DBGET integrated database retrieval system