KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120399Help
Entry
pRL120399         CDS       T00402                                 

Definition
(GenBank) putative GntR family transcriptional regulator
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FCD GntR Fe_dep_repress HTH_41 HTH_IclR TrmB HTH_5 Rrf2 HTH_Crp_2 HTH_11 TFIIE_alpha MarR_2 RepL
Motif
Other DBs
NCBI-ProteinID: CAK12108
GeneDB: pRL120399
RhizoBase: pRL120399
UniProt: Q1M464
Position
pRL12:431734..432492
Genome map
AA seq 252 aa AA seqDB search
MFSPVESRRLYRQVADQIRLMIASGELAVGQRLPAERDLAEQLSVSRPTVREALIVLEVE
GLVNIRMGSGIYVVRQHAATVTGAEREPVEGPFELLQARALIECAIAEEAAGRAKPDDIA
LLDEALTRMGGVVNDAIAVLDADRAFHTGIAAIVGNATLIRVTGEMFDMRMTPYFARLAS
HFEGPTTWRSALDEHRAIRDAIAAGDAAGAKAAMRAHLTMSQKRFSESFGEEFSGEEERG
RNKRPSKGTAKT
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgttttcgcctgttgaatcacgccgcctttaccggcaggtcgccgatcagattcgcttg
atgatcgccagcggcgagcttgccgtcggccagcggctgccggccgagcgcgacctggcg
gagcaactgtcggtttcacgcccgaccgtccgcgaggcgctgatcgtcctggaggtcgaa
ggcctcgtcaacatccgcatgggatccggcatctatgtggtgcgccagcatgctgcgacc
gtcactggggccgagcgagagccggtggagggcccgttcgagctgctgcaggcgcgcgcc
ctcatcgaatgcgccattgccgaagaagctgcaggccgcgccaaaccggacgatatcgcg
ctgctcgatgaagctctgacgcgcatgggtggtgtggtcaacgatgcgatcgcagtgctc
gatgccgatcgcgccttccacaccggcattgccgccatcgtcggcaatgcgacattgatc
cgcgtcacgggcgagatgttcgacatgcgcatgacgccttatttcgcaaggctcgccagc
cacttcgaggggcctacgacatggcgtagcgccctggacgagcatcgcgccattcgcgac
gcgatcgccgccggcgatgcagccggcgccaaggctgccatgcgcgctcatctcaccatg
tcgcagaagaggttttccgagagcttcggggaggagttctcgggggaagaggagcgcgga
cgcaacaagcggccgtcgaaaggaactgccaagacttaa

DBGET integrated database retrieval system