KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120403Help
Entry
pRL120403         CDS       T00402                                 

Definition
(GenBank) putative dehydrogenase
  KO
K00098  
L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Brite
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     pRL120403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL12:435712..436746
Genome map
AA seq 344 aa AA seqDB search
MRTRVARLYQKGDLRIETAAVAAPGPGEVLLKMAAAGICGSDLHYYQDGGFGPVRVREPI
IPGHEASGTVSQAGEGVDLKAGTLVAVNPSQPCGHCEYCQKNMPIHCLDMRFMGSAMRLP
HEQGMFREWLVVPAKQCFAVGAATTAAEAACSEPLSVCLHAASRAGDITGKRVLVTGAGP
IGALMVAVASYHHASEIVVTDLADAALDRAKAMGASRTINVSKNAQALAEFEAGKGYFDL
VFECSAAAPAIRGAIAAIRPRGTIVQVGVTGDVPIPLNAIVGKELQLHGTQRFHEEFGTA
VELISSRKIDVRPIISHSLPLEEATAAFTLAGDRAAACKVQLTF
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcggacacgtgtggcacggctttaccaaaagggcgacctcaggatcgagaccgccgcg
gttgcggcccctggtcccggggaggtgcttctcaaaatggcggccgcagggatttgcggc
tccgacctgcattattatcaggacggcggcttcgggcctgtccgggttcgcgagccgatc
atacccggccacgaggcctcggggaccgtgagccaagcgggcgagggcgtcgatctgaag
gctggcacgctggtggcggtcaatcccagccaaccctgcgggcattgcgaatattgccag
aaaaacatgccgatccactgcctggacatgcgcttcatgggcagtgcgatgcgcctgccg
catgagcagggcatgttccgggaatggctggtggtgccggccaagcaatgctttgcggtc
ggagctgcgacaaccgccgcggaagcggcctgcagcgagccgctctccgtctgcctgcac
gcggcatcgcgcgcaggagatatcacaggcaaacgcgtgctggtcaccggagccggcccg
atcggcgccctgatggttgccgtcgcctcctatcaccatgcaagcgagatcgtggtgaca
gatctcgcggacgcggcgctggaccgggccaaagcgatgggcgccagccgcacgatcaat
gtttccaaaaacgcccaggcgcttgccgaattcgaggcgggaaagggctatttcgatctc
gtcttcgaatgctcggccgccgccccggccatccgcggcgcaattgccgccatcaggccg
cgcggaacgatcgtgcaggtcggcgtcacaggagacgtcccgatcccgctcaacgccatc
gtcggcaaggagcttcaactccacggaacgcagcgcttccacgaggagttcggtactgcc
gtcgagctgatctccagccgcaagatcgatgtgcggccgatcatcagtcacagcctgccg
ctcgaagaagccaccgcagccttcaccctcgccggcgaccgcgcggccgcctgcaaggtg
caactgactttttag

DBGET integrated database retrieval system