KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120408Help
Entry
pRL120408         CDS       T00402                                 

Gene name
braG2
Definition
(GenBank) putative ATP-binding component of ABC transporter
  KO
K01996  branched-chain amino acid transport system ATP-binding protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle02010  ABC transporters
rle02024  Quorum sensing
Module
rle_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:rle00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    pRL120408 (braG2)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    pRL120408 (braG2)
Transporters [BR:rle02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    pRL120408 (braG2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 SMC_N RsgA_GTPase AAA_22 AAA_25 AAA_23 MMR_HSR1 AAA_30 AAA_27 AAA_15 DLIC AAA_16 AAA_24 AAA_33 AAA NACHT
Motif
Other DBs
NCBI-ProteinID: CAK12117
GeneDB: pRL120408
RhizoBase: pRL120408
UniProt: Q1M455
Position
pRL12:441076..441798
Genome map
AA seq 240 aa AA seqDB search
MIRDLRAGYGNLDILNGVDLDVPAGQFVALMGPNGAGKSTLLKTLYGMTTIKQGSIDWRG
KNIAGSKSRSILGEGISFVPQGRCNFPVMSVDENLQMAAYTLRDAKVKADRDYVYDLFPI
LKNRRATLAGNMSGGEQQLLEVAMAVLQRPKVLLVDEPSVGLSPAAIGIVFDELLRLHAD
GMTILLVEQNTKKAMEVAERAVILRLGKVIWDGLPKDITHDELGELFLTGKMRGETEAVH
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
ttgatccgcgacctgcgcgcaggttacggcaatctggatattctgaacggcgtcgatctc
gacgtgcccgccggacagttcgtggcgctcatggggccgaacggggcgggcaagtccact
cttctcaagacgctctacggcatgaccaccatcaagcagggaagcatcgactggcgcggc
aagaatatcgccggcagcaagtcgagatccattctgggcgaggggatttccttcgtgcct
caggggcgctgcaacttccccgtgatgagtgtcgatgaaaatcttcagatggccgcctat
accctccgcgacgccaaggtgaaggccgaccgcgattacgtctacgacctctttccgatc
ctgaagaatcgccgtgcgacgctcgcaggcaatatgtccggcggcgagcagcaactgctc
gaggtggcgatggcggtgctgcagcggccgaaagtgctgctggtcgacgagccgtccgtg
gggctgtcgccggctgcgatcggtatcgtcttcgacgaacttcttcgacttcacgcagat
ggcatgacgatcctgctggttgaacagaacaccaagaaagccatggaagtggcggagcgc
gcggtcattctgagacttggcaaagtcatctgggacggcctgccgaaagacatcacccat
gacgagctcggcgaactgttcctgaccgggaagatgcgcggcgaaaccgaagccgttcac
tga

DBGET integrated database retrieval system