KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120409Help
Entry
pRL120409         CDS       T00402                                 

Gene name
aatA3
Definition
(GenBank) putative aspartate aminotransferase B
  KO
K00812  
aspartate aminotransferase [EC:2.6.1.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Cysteine and methionine metabolism
Arginine and proline metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    pRL120409 (aatA3)
   00270 Cysteine and methionine metabolism
    pRL120409 (aatA3)
   00220 Arginine biosynthesis
    pRL120409 (aatA3)
   00330 Arginine and proline metabolism
    pRL120409 (aatA3)
   00350 Tyrosine metabolism
    pRL120409 (aatA3)
   00360 Phenylalanine metabolism
    pRL120409 (aatA3)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    pRL120409 (aatA3)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    pRL120409 (aatA3)
Enzymes [BR:rle01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     pRL120409 (aatA3)
Amino acid related enzymes [BR:rle01007]
 Aminotransferase (transaminase)
  Class I
   pRL120409 (aatA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL12:441840..443048
Genome map
AA seq 402 aa AA seqDB search
MSTFVPASRVSRIKVSPSTAAAARARELKAAGRDIVDLTVGEPDFDTPDNIKAAAHAAID
RGETKYTAVNGTPALRKAIIGDIKRRLGLSYADNEICVGGGAKQILFLALMASVENNAEV
IIPAPYWVSYPDMVIANEGKPVIIECPQETGFKLTPEALERAITPKTLWLVLNAPSNPTG
AAYDRSELEALGKVLLRHPHVFVLSDDIYDQVWFKDEPMTTLVAAVPELKERVLLTNGVS
KSYAMTGWRIGYAAGPAVLIAAINKLQSQMSSCPSSVSQAAAAYALSSDQSFVTESVTVY
RKRRDYACSRLNAVPGLSCLVPDGAFYLFPNCAGVIGKKTPEGKTIETDLDFVLYLLDGV
GVAALQGAAYGVSPHFRLSIATSMEAITQACDRIERAVADLY
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagcacttttgtgcctgcatcgcgtgtgtccagaatcaaggtttcgccaagcacggct
gcggcagcccgggctcgcgaactgaaggcagccggccgcgatatcgtcgacctgaccgtc
ggcgagccggacttcgatacgcctgacaacatcaaggccgcggcgcacgcggccatcgac
aggggcgaaaccaaatataccgccgtcaacggcacgccggcgctgcgcaaggcaatcatc
ggcgatatcaagcgccggctcggcctcagctacgcagacaacgaaatctgcgtgggtggc
ggcgccaagcagattctgtttctggcgcttatggcgagcgtggaaaacaatgccgaggtg
atcatccccgcaccatactgggtctcctatcccgatatggtcatcgccaacgaaggcaag
ccggtcattatcgaatgcccacaggaaacaggcttcaagctcacgccggaggctttggaa
agagcgatcacgccgaagaccttgtggctggttctcaacgcgccgtccaatccaacgggc
gcggcatatgacaggagcgagctcgaagccctcggcaaagtgctgctgcgccatccccac
gtcttcgtgctttccgacgacatttacgaccaggtctggttcaaggacgagccgatgacg
acgctggtggccgccgtcccggaactgaaggagcgtgttctgctcaccaacggcgtctca
aagtcctacgccatgaccggatggcgtatcggctacgcggcgggtccggccgtcttgatc
gcagccatcaacaagctgcagtcgcagatgtcgtcctgcccgtcgtcggtcagtcaggcc
gcagccgcctatgcgctgtcttcggaccagtcattcgtcacggaaagcgtgacggtctac
agaaagcgccgggattatgcgtgctcacggctcaacgcggtgccaggcctctcctgcctg
gtgcctgacggcgctttctatctgtttccgaactgcgctggtgttatcggcaagaagacc
cccgaaggtaagacaatcgagacagacctcgatttcgtgctctatctgctcgatggcgtc
ggggtcgcggcgctgcagggtgccgcctacggagtatcgcctcatttccgtctctcgatc
gcaacgtcgatggaggcaatcacgcaggcatgcgatcgcattgaacgggctgttgccgac
ctgtattga

DBGET integrated database retrieval system