KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120415Help
Entry
pRL120415         CDS       T00402                                 

Gene name
dadR
Definition
(GenBank) putative AsnC family alanine catabolic operon regulator
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AsnC_trans_reg HTH_24 HTH_AsnC-type HTH_20 MarR HTH_Crp_2 HTH_5 HTH_11 MarR_2 HTH_3
Motif
Other DBs
NCBI-ProteinID: CAK12124
GeneDB: pRL120415
RhizoBase: pRL120415
UniProt: Q1M448
Position
pRL12:complement(449625..450089)
Genome map
AA seq 154 aa AA seqDB search
MPALDAIDRNILRLLRLDARMSNAKLAAEIGLSPSACLRRIKIMEKSGVIRGYTVLVDTG
NADEMIAVIINITLERQTEDYLDRLEAAVRRHPEIRECFLMTGGSDYLLRVEVANAGEFE
RIHKEILSTLPGVLRIHSSFSIRNVLATRTRGRR
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctctcgacgccatcgatcgcaatatcctgaggctactgcgcctcgatgcccgc
atgagcaatgccaagctcgccgccgagatcggtctttctccctcggcctgcctcaggcgc
atcaagatcatggaaaaatcaggcgtgatccgcggctatacggtgctggtcgacaccggc
aatgcggatgagatgatcgccgtgatcatcaacatcactctagagcgacaaacggaggac
tatctcgaccgcctcgaggcggcggttcggcggcatcccgagatccgggaatgttttctg
atgacgggcggttccgactatctgctgcgcgtggaggttgccaatgcgggcgagttcgag
cggatccacaaagagatactgtcgaccttacccggcgtcctcagaattcattccagcttc
tcgatccgcaatgttctggcgacgcgcacgaggggcaggcgctga

DBGET integrated database retrieval system