KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120416Help
Entry
pRL120416         CDS       T00402                                 

Gene name
dadX
Definition
(GenBank) putative alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    pRL120416 (dadX)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    pRL120416 (dadX)
Enzymes [BR:rle01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     pRL120416 (dadX)
Peptidoglycan biosynthesis and degradation proteins [BR:rle01011]
 Precursor biosynthesis
  Racemase
   pRL120416 (dadX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL12:450216..451349
Genome map
AA seq 377 aa AA seqDB search
MDSDILVSRTRTATIAQGATGYLMIDLAALGRNYRKLVSMLAPVRAGAVVKADAYGLGAE
RVARTLYSEGCRHFFVAQFVEAVRLRPALAHDAQIFVLNGLQPGNEIACAEMGIVPVLNS
LAQWRQWSAAARILKRCLPAVLQFDTGMSRLGFPREERRELAAALRDGSNVEILFIMSHL
ASADDMGSEQNGEQFAEMSRIADEFPGFDISFANSGGVFLGEAYYGVLARPGIALYGGAP
NAGEKNPMEPVVSLNVAVVQTRTVPAGAKVGYGGAHVTQRETRLATIAAGYADGLPRCLS
DRGAVYFKGVRLPIVGRVSMDSTTVDITALPEGALTFGSLVEVLGRHQTLEDIARDAGTI
SYEILTGLGDRYDRQYR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggatagcgatattttggtttcccgcacacgcaccgctacgatcgcgcagggagccacg
ggctatctgatgatcgatcttgccgccctcggccgtaactatcgcaagctcgtatcgatg
ctggcaccggtccgcgccggcgccgtcgtcaaggccgatgcctatggtctcggcgccgag
cgggtcgcgagaacgctttacagtgaaggttgcaggcatttcttcgtcgcccaatttgtc
gaggccgtgaggctcagaccggcccttgcgcacgacgcccagattttcgtgctgaacggc
ttgcagccgggcaacgagatcgcctgcgccgagatgggcattgtcccggttctcaattcg
ctggcgcagtggcggcagtggtcggcggctgcgcgcattctgaagcgctgcctgccagcc
gtcctccaattcgacaccgggatgtcgcggctcggttttccccgggaagagcgaagagag
ctggcggcggctcttcgcgatggcagcaatgtcgaaatcctgttcatcatgagccatctg
gcttcggccgatgacatgggcagcgagcagaacggcgaacagtttgccgagatgtcccgc
atcgccgacgaatttcccggcttcgacatttccttcgccaattccggcggcgttttcctg
ggcgaggcctattacggcgtactcgcccgccccggcatcgcgctttatggcggcgctccg
aacgccggcgagaagaacccgatggagccggtcgtcagcctcaatgtcgccgttgtgcag
acgcgcaccgtaccggcgggtgcgaaggtcggctatggcggcgcgcatgtcacgcaacgg
gaaacgcgtctcgccaccattgccgccggctatgctgatggcctgccgcgatgcctcagc
gaccgcggcgccgtctatttcaagggcgtccgcctgccgatcgtcggccgcgtgtcgatg
gacagcacgaccgtcgacatcacagcactgcccgaaggggcgctgaccttcggcagtctc
gtcgaagtgctcggccgccatcagacgcttgaggacatcgcgcgcgatgccggcaccatt
tcttacgaaatcctaactggcctgggcgatcgttacgacaggcaatatcgctaa

DBGET integrated database retrieval system