KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120430Help
Entry
pRL120430         CDS       T00402                                 

Definition
(GenBank) putative ATP-binding component of ABC transporter
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle02024  Quorum sensing
Module
rle_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:rle00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    pRL120430
Transporters [BR:rle02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    pRL120430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 AAA_22 SMC_N TniB AAA_16 AAA_29 DUF87 ABC_ATPase G-alpha
Motif
Other DBs
NCBI-ProteinID: CAK12139
GeneDB: pRL120430
RhizoBase: pRL120430
UniProt: Q1M433
Position
pRL12:complement(463070..464038)
Genome map
AA seq 322 aa AA seqDB search
MTQSDVVIDIQNLSVTFNRGRKPVKAVNGVSLQVRAGEVVALLGESGSGKSVTMRSLLRM
HPKGTTIDGSMSVAGREVTGLSTRELGNLRGAVVSMVFQEPRLALDPVYTLGRQIEETIM
RHEKISRSAAAARSLALFEKVRIPSPERRLQNYPHEMSGGMLQRSMIAMALACNPKVLLA
DEPTTALDATVQIQILLLIRELQKEYGLSVIFVTHDIGVAAEVADRIAVMYAGRVVEEGR
VEDIIREPKHPYTKGLLGARVELANGRDRLITIPGAPPDLANMPPGCAFAPRCAQVSEPC
LTEVPALVAAGRAGRVACLLYG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatccgatgttgtgatcgatattcagaacctctccgttaccttcaatcgagga
cgcaagccggtgaaggccgtcaatggcgtcagcctccaggtaagggctggcgaggtcgtg
gccctcctgggggagtccgggtcgggcaagagcgtcaccatgcgctcgctgcttcgtatg
catccgaaggggacgacaatcgacgggtcgatgtcggtggccggacgcgaggtcaccggc
ctgtcgacgcgcgagctcggcaatctgcgtggcgccgtcgtgtcgatggtgtttcaagag
ccgcgtcttgccctcgatccggtctacacgcttggccggcagatcgaagagacgatcatg
cgccatgaaaagatttctcgctccgccgcggctgcccggtcgcttgccttgtttgagaag
gttcgcattccctcgccagagcgtcgccttcagaattacccccacgagatgtcgggcggc
atgttgcagcgctcgatgatcgccatggcgctggcgtgcaatccaaaggtccttctcgcc
gatgagccgacgacggcgctggatgccaccgtacagatccagatcctgctgctaatccgc
gaattgcagaaggagtatggattgtccgtcatcttcgtaacccacgatatcggcgttgct
gccgaggtcgctgaccgcatcgcggtcatgtacgcgggacgggtcgtcgaggaggggcgc
gttgaagacatcatccgcgagccgaaacatccctatacaaaagggctgctcggcgcgcgc
gttgaacttgcaaacggccgcgatcgactgatcaccattccgggcgcgccgccggatctg
gccaacatgccgcccggctgcgcgtttgcgccacgatgcgcgcaggtatcagaaccctgt
cttaccgaagttccggcactcgtcgcagcgggacgagctggccgggttgcctgccttcta
tacggctga

DBGET integrated database retrieval system