KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120441Help
Entry
pRL120441         CDS       T00402                                 

Definition
(GenBank) putative ABC transporter component
  KO
K11963  urea transport system ATP-binding protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle02010  ABC transporters
Module
rle_M00323  Urea transport system
Brite
KEGG Orthology (KO) [BR:rle00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    pRL120441
Transporters [BR:rle02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Urea transporter [MD:M00323] [OT]
    pRL120441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_23 AAA_29 AAA_22 SMC_N AAA_16 ABC_ATPase RsgA_GTPase AAA_30 NACHT AAA_25 MobB AAA_13 AAA_15 RecA DLIC AAA_19 AAA cobW ATPase AAA_24 DUF3584
Motif
Other DBs
NCBI-ProteinID: CAK12150
GeneDB: pRL120441
RhizoBase: pRL120441
UniProt: Q1M423
Position
pRL12:complement(475436..476131)
Genome map
AA seq 231 aa AA seqDB search
MLSLKDVHSYYGRSHILHGITLDVPAGKVTSILGRNGTGKTTLLKTLMALTDRMTGEMRL
QGKDIALSPTHVRARAGIAYVPQGREIIPDFTIRENILMGAFARTDGKREIPALVPELFP
YLMANLDRPGGVLSGGQQQQLAIARALAADPKVLLLDEPNEGIQPSIVEEIEKIIIRLNR
EIGMTIILVEQNVAFARHASHQFAMLEKGGVVAAGAIDTLSDALVHRHMAV
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcgttgaaagacgtgcacagctactacggccgcagccatatcctgcacggcatc
acgctcgatgttccggccggcaaggtgacgagcattctcggccgcaacggcaccggcaag
acgacgctgttgaaaaccctgatggcgctgaccgaccgcatgacgggcgagatgcgtctg
cagggaaaagacatcgccttgtccccaacgcatgtgagggccagggccggtatcgcctat
gtcccccagggcagggagatcattcccgattttaccatccgtgagaacatcctgatgggc
gcctttgcccgcaccgatggcaaacgcgagattccggcgctggtgccggagctcttccct
tatcttatggccaacctcgatcgacctggcggcgtgctttcgggcggtcagcaacagcag
cttgctatcgcccgcgcgctggccgccgacccaaaggtgcttcttctcgatgaaccgaac
gaaggcatccagccctccatcgtcgaggagattgaaaagatcatcatccggctcaatcgc
gagatcggcatgacgatcattctcgtcgagcaaaacgtcgcctttgcgcggcacgcgtct
catcagttcgcaatgctggagaagggaggcgtggtcgcggccggcgccatcgacacgctc
tccgacgcgcttgttcatcggcatatggctgtctga

DBGET integrated database retrieval system