KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120445Help
Entry
pRL120445         CDS       T00402                                 

Definition
(GenBank) putative substrate-binding component of ABC transporter
  KO
K11959  
urea transport system substrate-binding protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
ABC transporters
Module
Urea transport system
Brite
KEGG Orthology (KO) [BR:rle00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    pRL120445
Transporters [BR:rle02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Urea transporter [MD:M00323] [OT]
    pRL120445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL12:complement(479067..480317)
Genome map
AA seq 416 aa AA seqDB search
MVFNRREFLKTAATASAALALPALGSRAFAADAIKVGALYSQTGGLSVAEKLLANGVMMA
VAEINATGGVLGRPVEVVVEDGASDPKTFSEKASKLILKDKISTVFGCHTSASRKAVLPI
FERRGAMLFYQTHYEGFECSRNVVYSGAVPNQQLSNYIPWIVEKLGKKKFFIVGSNYVYP
REMAKVSKKLIEAAGAEWVADEYLELGHSEWAVMVSKIKESGADVVLSNVVGDSIIAFYR
EFKNQGLSQEVLPICATVTSEIEIAAMGAEYAAGSYTSFPYFMSIDTPANKSFIDRFRTF
VNDPKAVTYHSLEAAYFQVFLWKQAVEKSGDLSADAIRAGIRSQTYEAPGGKVTTDPDNL
HCWLTPRIGQWQADGQSKVVNAYPAPIKPLPYSAYGETESNLFCTSNGLDAAKLKG
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggtgttcaacagacgtgaatttctgaaaaccgcagcgaccgcttccgccgcactcgcc
ctgccggctctgggcagccgcgccttcgcagccgatgccatcaaggtcggcgcgctttac
tcgcagacgggcgggctttcggttgccgagaagcttctggcgaacggcgtcatgatggcc
gtggccgaaatcaacgcgaccggcggtgtactcggtcgccccgtcgaggtggtcgtcgaa
gacggtgcttccgatccgaaaaccttcagcgagaaggcttcgaaactgatcctcaaggac
aagatttcgaccgtgttcggctgccacacatcagcaagccgcaaggccgtgctgccgatc
ttcgagcgacgtggcgccatgctgttctaccagacgcattacgaaggcttcgagtgctcg
cgcaacgtcgtctattccggcgccgttccgaaccagcagctctccaactacattccctgg
atcgtcgagaaactgggcaagaagaaattcttcatcgtcggctcgaactatgtctatccg
cgcgaaatggctaaggtttccaagaagctgatcgaggcagccggcgccgagtgggtggcg
gacgaatatctggaacttggccattcggaatgggccgtcatggtcagcaagatcaaggag
tcgggcgccgacgtggtcctgtccaacgtggtcggcgactccatcatcgccttctaccgc
gagttcaagaaccaggggctctcgcaggaggttctgccgatctgcgcgacggtcacctcc
gaaatcgagatcgcggcgatgggcgccgaatatgccgccggaagctacacctccttcccc
tattttatgtcgatcgacacgccggcgaacaagagcttcatcgatcgcttcaggaccttc
gtcaacgatccgaaagccgtcacctaccattctctcgaagccgcctattttcaggtcttc
ctgtggaagcaggccgtcgaaaaatccggcgacctgtccgcggacgcgatcagggccgga
attcgcagccaaacctacgaagcgcccggcggcaaggtgaccaccgaccccgacaacctg
cattgctggctgacgccgcgcatcgggcaatggcaggcggacggccagagcaaggtggtg
aacgcctacccggcgccgatcaagcctctgccctattcggcctatggggagacggagagc
aatctgttctgcaccagcaacggtctcgacgccgcaaagctcaagggctga

DBGET integrated database retrieval system