KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120453Help
Entry
pRL120453         CDS       T00402                                 

Definition
(GenBank) Putative transcriptional regulatory protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL12:complement(488239..490116)
Genome map
AA seq 625 aa AA seqDB search
MHADIVLHNGRITTLDRANPNATAIAVKDGLFLEVGTDSEVMALAGLDTKIVDLKGKRVL
PGLIDNHTHVVRGGLNFNMELRWDGVRSLADAMDMLKRQVAITPAPQWVRVVGGFTEHQF
TEKRLPTIDEINAIAPDTPVFLLHLYDRALLNGAALRAVGYTKDTPNPPGGEITRDANGN
PTGLLLAKPNAGILYSTLSKGPKLPFEYQVNSTRHFMRELNRLGITGVIDAGGGFQNYPD
DYAVIQKLSDEDQLTVRLAYNLFTQKPKEEKQDFLNWTQSVKYKQGNDYFRHNGAGEMLV
FSAADFEDFRQPRPEMAPEMEGELEEVVRVLAENRWPWRMHATYDETISRSLDVFEKVNK
DIPLEGLNWFFDHAETISDRSIDRIAALGGGIATQHRMAYQGEYFVERYGHGVAEATPPI
RRMLDKGVNVSAGTDATRVASYNPWVSLAWMVTGKTVGGMQLYPRANCLDRETALRMWTE
KVTWFSNEEGKKGRIEKGQFADVVVPDKDFFTCAEDEISYLTSQLTMVGGKIVYGAGDFA
ALDENDVPPAMPDWSPVRTFGGYAAWGEPQGAGVNSLRRTAISTCGCASSCNVHGHDHAG
AWTSKLPIADLKGFFGALGCACWAV
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgcacgccgatatcgttcttcacaatgggcggatcacaacgcttgaccgcgcaaatccg
aacgccaccgcgatcgccgtgaaagacggcctgttcctcgaggtgggaaccgacagcgag
gtgatggcgctcgccggactggatacgaagatcgtcgacctcaagggcaagcgcgtgctt
cccggcctgatcgacaaccacacgcatgtcgtgcgtggcggcctcaacttcaacatggaa
ctccgctgggacggtgttcgctcgcttgccgatgcgatggacatgttgaagcgacaggtg
gcgatcacgcccgcgccgcaatgggttcgcgtggtcggtggttttaccgagcatcagttt
accgagaagcgcctgccgacgatcgacgagatcaacgcgatcgcacccgataccccggtc
ttcctgctccacctctatgaccgcgcgctgctgaacggcgccgcccttcgcgccgtcggc
tataccaaagacacgccgaaccctccaggcggcgagatcacccgcgatgccaacggcaat
ccgacggggcttctgcttgccaagccgaatgcgggcattctctattcgaccctttccaag
gggccgaagcttccgttcgaatatcaggtcaattccacccgccacttcatgcgcgaactc
aaccggctgggcatcaccggcgtgatcgacgccggcggcggtttccagaactatccggac
gattatgcggtcatccagaagctttcggacgaggaccagttgacggtgcgcctcgcctac
aacctgttcacgcagaagccgaaggaagagaagcaggacttcctcaactggacgcagtcg
gtcaaatacaagcagggcaacgattacttccggcataacggcgctggggagatgctcgtc
ttctccgccgccgacttcgaggatttccgtcaaccacggcccgaaatggcgccggaaatg
gaaggagaacttgaggaagttgttcgcgtgcttgccgagaaccgttggccctggcgcatg
catgccacctatgacgaaaccatttcccgttcgctcgacgtcttcgagaaggtcaacaag
gacattccgctcgaaggtttgaactggttcttcgaccatgccgaaacgatctcggatcgt
tcgatcgaccggatcgcggcgctcggcggcggcatcgccactcagcaccgcatggcctat
cagggcgaatatttcgtcgagcgctacggtcacggcgtcgccgaggccacgccgccgatc
aggcgcatgcttgacaagggcgtcaacgtatcggcagggactgacgcgacgcgtgtcgcc
tcctacaatccatgggtttcccttgcctggatggtgaccggcaagacggtgggcggcatg
cagctctacccgcgcgccaactgcctcgaccgcgagacggcgctgcgcatgtggacggaa
aaggtgacctggttctccaacgaggaaggcaagaagggccggatcgaaaaaggccagttt
gccgacgtcgtcgtgccggacaaggacttcttcacctgcgccgaagacgagatctcgtac
ctcacctcgcagttgaccatggtcggcggcaagatcgtctatggcgcgggcgattttgcg
gcgctcgacgagaatgacgtcccgcccgccatgcccgactggtcacccgttcgcacgttc
ggcggctatgcggcctggggtgaaccgcagggtgccggcgtgaattccctgcgccggacg
gcaatctcgacctgcggctgcgccagttcctgcaatgtccacggtcacgaccacgctggc
gcctggacatcgaagctgccgatcgccgatctcaagggcttcttcggcgcccttggctgc
gcctgctgggcggtgtga

DBGET integrated database retrieval system