KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120457Help
Entry
pRL120457         CDS       T00402                                 

Definition
(GenBank) putative LysR family transcriptional regulator
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL12:492421..493320
Genome map
AA seq 299 aa AA seqDB search
MNDYKLLRTFLLAAEKRNFAQVARELDMTPAAVTRAIAALEEDLGVQLFVRTTRQVSLTT
DGAIFAAQIQPAVQTLDNARKDLMNTHKADHGRLRISAPTWFGQQVLPPILSAFRERYPK
ISFEISLADGLVNIIDDDYDLAIRISAAPSDKFTIWRKISVVHRILVAAPGSRFCDMKHP
NELIPDDCLAYSGDSKRETWALSDGSGSATISAGRAVSANSGEVLASMAADGAGVAMLPK
FHVAEHLRTGRLAHVLQDWSPPDLWLTLYYPPYQALPPRIASFSKFFEQQIPAFISAIE
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaacgactacaagctgcttcgaacctttctactggccgccgagaagcgcaacttcgcg
caggtcgcgcgcgagctcgacatgacccccgcagccgtcactagggcaatcgcggccctg
gaagaagatcttggcgtgcaactctttgtgcggaccacgcgccaggtatcgctgacgact
gacggcgcgatcttcgccgcacagatccagccggccgtgcagacgttggacaatgcgcgc
aaggatctgatgaatacccacaaggcggatcatggccgcctgcggatcagcgcaccgacc
tggttcggccagcaggtcctgccgcctatcctttccgcattcagggaacgctacccgaag
atcagcttcgagatctcgcttgccgatgggctcgtgaatatcatcgacgacgattacgat
ctggcgatccgcatttccgcagccccctcggacaagttcacgatctggcgcaagatcagc
gtcgttcaccgcatcctcgtcgcagcgcccggcagccggttttgcgacatgaagcacccg
aatgaactcattcccgacgattgcctggcctatagcggtgacagcaaacgggagacctgg
gcactgtcggatggcagtggcagcgccacgatttctgccggccgcgcagtcagcgccaat
agcggggaagtgctcgcgagcatggctgccgacggcgccggggtcgcgatgctgcccaag
ttccatgtggccgagcatctgcggaccggacggctggcccacgtcctgcaggactggtcg
ccgccggacttgtggctgaccctgtactatccgccgtatcaggcgcttccgccgcgcatc
gcctcattctcgaagttcttcgagcaacagatcccggcgtttatatcggcaatcgaatga

DBGET integrated database retrieval system