KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120459Help
Entry
pRL120459         CDS       T00402                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K08995  
putative membrane protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL12:complement(493892..494557)
Genome map
AA seq 221 aa AA seqDB search
MTDVDDTRPPRVRNFWEPFRPSCIQCSLPKAHIVPAGRHPVTTKGRQIMLKRILGATLLA
ASLGTASLAADAKRTDPQIAHIAYTAGQIDVTAAEQALKKSKNADVIAFAKTMERDHKAV
NDQALALVKKLKVTPGDNPVSQSLSTQATKELTTLEALDGAAFAKAYVENEVAYHKSVND
ALANILIPSAQNKELKSLLETGMPLVQGTSEHAEHLASMIK
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgtcgatgacacccggcctccccgtgtccgaaatttctgggaaccttttcgt
ccgagctgcatccaatgctcgcttccgaaggcacacatcgttcccgccggaaggcatcca
gtcacgacaaaaggaagacagatcatgttgaaacgaattctcggcgccactctgctggcg
gcatcgctcggcacggcttcgctcgccgccgatgccaagcggaccgatcctcagatcgcc
cacatcgcctatacggcgggacagatcgatgtcaccgcggcagagcaggcgctgaagaag
agcaagaatgccgacgtcattgcattcgccaaaaccatggagcgcgaccacaaggccgtc
aacgaccaggcgctcgccctcgtcaagaagctgaaggtgacgcccggagacaaccccgtc
agccagtccctttcgacacaggcgaccaaggaactgacgacgctggaagcgctcgacggc
gcggcattcgccaaggcctatgtcgaaaacgaggtcgcctatcacaagtcggtcaacgac
gcgcttgccaacatcttgatcccttcggcgcagaataaagagctcaagtcgctgctggaa
acgggcatgcctcttgttcaaggaacatccgagcatgccgagcatctagcttcgatgatc
aagtag

DBGET integrated database retrieval system