KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120463Help
Entry
pRL120463         CDS       T00402                                 

Gene name
impM
Definition
(GenBank) putative protein involved in nitrogen fixation
  KO
K11890  type VI secretion system protein ImpM
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Brite
Secretion system [BR:rle02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   pRL120463 (impM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2094 PP2C_2 SpoIIE PP2C
Motif
Other DBs
NCBI-ProteinID: CAK12172
GeneDB: pRL120463
RhizoBase: pRL120463
UniProt: Q1M401
Position
pRL12:complement(497215..498588)
Genome map
AA seq 457 aa AA seqDB search
MNERATLDRSPTEADRIGFFGKLPSHGDFVSMGLSRHLQAALDAWLQSGLQASQRELGED
WERRFRMMPAWRFIVERGLWGSATIAGVLLPSLDRVGRSFPLVIAAQLHGFAEHPRQLYL
DDTWFTAAEAIAESSAKRDFDINHFTASLKRLRTLRPADLGENETLQDNASGRGTLWWRI
SPEDRRAKGFRVGGAPDPEDFPKLLHDNPPAASARPQPETAETPRPVVVEPHHPLVIRHS
HATHPGTRLSVNADALLVSETPSLFAVADGVGDGNAAAEVGKIAVHMLAETGNQQTIEAL
VQEIKGKLGRAHGLLQSAYLSSDREPSAASIVVLATRDESCALLWVGDARCYLLRDGMMR
CLTRDHVEIGLRRTLSRAIGMRGHLVPEVRSGGLQAGDRLLLCSAPLPSVVPERIIAEIL
LSAKIEKAADILVQEGLIANCRENLSAVVIDVKTDDK
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagcgcgccaccctggaccgaagcccgaccgaagccgacaggatcggcttcttc
ggcaaattgccgagccatggcgatttcgtttcgatgggactgagccgccacctgcaggcg
gcactagacgcctggctgcagtcggggctgcaagcgtctcagcgggaactcggcgaggat
tgggaacgccggtttcgcatgatgccggcatggcgttttatcgtcgaacgcggtctttgg
ggatctgccaccattgccggcgttctgcttccgagcctcgaccgcgtcgggcgcagtttt
ccgcttgtgatcgccgcccagcttcacggttttgccgagcatccacgccagctctacctt
gatgacacctggttcacggccgccgaggcgatcgccgaaagctcggccaagcgggatttc
gacatcaatcacttcaccgcgagcctgaagcgactgcggaccctgcgcccggccgacctc
ggggaaaacgagacgctgcaggacaatgcttccggccgcggcacgctctggtggcggatc
agccccgaggatcggcgagccaaggggtttcgtgtcggcggcgccccggaccccgaggat
tttccaaagctgctgcacgacaatccccccgcggcttcggcacggccgcaacccgaaacg
gccgagacgccgcgccctgttgtcgtcgagccacatcatccgctggtgatccgccacagc
catgccacgcatcccggcacgcggctgagcgtcaacgccgatgcgctgctcgtttcggaa
acgccctcgctctttgccgtcgccgatggcgtcggcgatggcaacgccgctgccgaggtc
ggcaagatcgccgtccatatgctggctgaaaccgggaaccagcagacgatcgaagctctg
gtacaggagatcaaaggcaagctcggccgcgcccatggcctgcttcaatcggcctatctt
tcctcggatcgcgaaccatcggccgcgagcatcgtcgtgctggccacgcgtgatgagagc
tgcgctctgctctgggtgggtgacgcccgttgctatcttctgcgggacggcatgatgcgc
tgcctcacgcgcgaccatgtggagatcggcctgcggcgcacgctttcgcgcgccatcggc
atgcgcggacatctcgtccccgaagtccgttccggcggattgcaggccggcgacaggctg
ctgctctgcagcgcgccgctgccgagcgtcgtccccgagcggatcatcgccgaaatcctc
ctttccgcaaagatcgaaaaggccgccgatatcctcgtccaggaggggctgattgccaat
tgccgcgaaaacctcagcgcagtcgtgatcgatgtgaagaccgatgacaaatga

DBGET integrated database retrieval system