KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120465Help
Entry
pRL120465         CDS       T00402                                 

Gene name
ompA
Definition
(GenBank) putative outer membrane porin involved in nitrogen fixation
  KO
K11892  type VI secretion system protein ImpK
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rle00001]
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    pRL120465 (ompA)
Secretion system [BR:rle02044]
 Type VI secretion system
  Imp/Vas secretion system core components [MD:M00334]
   pRL120465 (ompA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU OmpA
Motif
Other DBs
NCBI-ProteinID: CAK12174
GeneDB: pRL120465
RhizoBase: pRL120465
UniProt: Q1M3Z9
Position
pRL12:complement(502072..503604)
Genome map
AA seq 510 aa AA seqDB search
MKNEPASTWQNLPTIVELTEDGTRKKQSARKMAEMLDDVLDFPESEGGKTPAGSLPKGAA
SVETLVRDFRFGAEDVPTLVRSAAPLLNLAHGLRYTEEQPDIDELRQVAIEAVGRYERDL
ASARISPERARAAHYVICATVDDVVLSKAWGVRAGWARSGLVSTFHMDVTGGERVFDLLD
HFHQSPGANKDLLLLIYLCLSLAFEGRTRVSPRGGLELGRIRDGLYKTLLGQYGVFEREL
SPHWKGVSARHQPLRTAAAIWTLLSLLTLILALGYMFFTLSLNRASDGTFERLARLPPRD
MPSVLVKVPEPPRQQPPVVVAETPPPPPPPQVKPPSRLDNLLAFLQPEVEKKLVTLSDSN
GRLLVRISNSGLFATGSAEVSQKFHDLLQRIGGALAAENFRAVVVGYTDNVPIRTVQFPS
NWHLSEARAKAVGEILSSFTGPGAILTEGRADTDPIAANDTPEGREMNRRTEILVLTDPS
ERLNDAGLTTPRRADMPDEPTAPAAGGGSR
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacgaacccgcctccacctggcagaacctgccgaccattgtcgaacttaccgag
gacggcactcggaaaaagcaatccgcccgcaagatggcggagatgctggatgacgtcctc
gactttcccgaaagcgagggcggaaagacgccggcgggatcgcttccgaagggcgcagcc
tccgtcgaaacgctcgtccgggattttcgcttcggagccgaagacgtgccgacgctggtg
cgctcggccgcaccgctcctcaacctcgcccatggcctgcgctacacggaagaacagcct
gatatcgacgaactgcgccaggtggcgatcgaagccgtcggccgctacgaacgcgatctg
gcgagcgcccgcatcagccccgaacgagcgcgcgccgcccattacgtcatctgtgcgacg
gtcgacgatgtcgtgctcagcaaggcctggggcgttcgcgccggctgggcccgctcgggg
ctcgtttccaccttccatatggacgtgaccggcggcgaacgggtgttcgacctgctcgac
catttccaccagagccccggcgccaacaaggacctgcttctcctcatctatctctgcctg
tcacttgccttcgagggccgcacccgcgtttcaccgcgcggcgggctggagctcggccgc
atccgcgacggcctttacaagacgctgcttggccagtacggcgtcttcgaacgagagctt
tctccccactggaagggcgtttcggcccggcatcagccgttgcgcaccgcggccgcgatc
tggacgcttctttcccttctgacgctgatcctggcgctcggctacatgttcttcacgctc
tcgctcaatcgcgcctccgacggaacgttcgagcggctcgccaggctgccgccgcgcgat
atgccgagcgtactcgtcaaggttccggagccgcctcggcagcagccgcccgtcgtcgtc
gccgaaacgccgccgccgccgccaccgccgcaagtgaaaccgccgagccggctcgacaat
ctgctcgccttcctccagccggaggtcgagaagaagctcgtcacactctcggattcgaat
ggcaggctgctggtgcggatcagcaattccggcctgtttgccaccggcagcgcggaggtc
agtcaaaaattccacgatcttctccagcggatcggcggtgcgctggccgcagagaacttc
cgcgccgtggtggtgggttataccgacaatgtgccgatccgcaccgtgcagttcccctcc
aactggcacctttccgaagcccgcgccaaggcggtcggcgaaatcctgagctccttcacc
gggccgggtgcgatcctgaccgaggggcgtgccgacaccgatccgatcgccgccaacgat
acgccggagggccgggagatgaaccgccgcaccgagatcctggtcctgaccgatccgagc
gagcggctgaacgatgcgggtttgacgacgccgcgtcgggccgacatgccggatgaaccg
acggcgcccgccgcaggaggtggttcgcgatga

DBGET integrated database retrieval system