KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120468Help
Entry
pRL120468         CDS       T00402                                 

Gene name
impH
Definition
(GenBank) conserved hypothetical protein involved in nitrogen fixation
  KO
K11895  
type VI secretion system protein ImpH
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Brite
Secretion system [BR:rle02044]
 Type VI secretion system
  Imp/Vas secretion system core components [MD:M00334]
   pRL120468 (impH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL12:complement(506142..507143)
Genome map
AA seq 333 aa AA seqDB search
MDLPTARKPDALADLLERDPGRFEPVTAFRVAQASVREGRLDVASHVGVSPAPLAVSGYK
RKGGSATVRSALAGLVGALGSMPSAYNDLVMREERNRSRALAGFFDMFGARMAELFTDAC
EKYRIARRLRWGGAWANNAFVTTLLSLTGFGTKRLVEKSGVDEELILRFSGFFAARNRNA
VNLRAMLCEFSGLPVEIELFRGRWLTIPIEERSRIGQPQGVQLGVNATAGAAIHDFSGGF
RIVIGPLGYADYLSLAPGGRAITELFALARLYVGAALEFDIQAILKKEDVPFCQLGQAGD
PPRLGWNSWARVAPAASDSGDAVIVERLSVQAR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggatctcccgaccgcccgcaagccagacgcccttgccgatctgctcgaacgcgacccc
ggccgcttcgagccggtgacggcctttcgcgtcgcgcaggcttcggtgagggaaggacgg
cttgatgtcgcctcgcatgtcggcgtctcgccggcgcctcttgccgtcagcggatataag
cgcaagggcggcagtgccaccgtccgcagcgcgcttgccggtctcgtcggggcgctcggc
tcgatgccgtcggcctataacgacctcgtcatgcgcgaggagcgcaacaggtcgcgggcg
ctggcgggcttcttcgacatgttcggcgcgcggatggcggaactcttcactgacgcctgc
gagaaatatcgtatcgccaggcggctgcgatggggcggcgcatgggcaaacaacgccttc
gtcaccacgctcctgtcactcaccggcttcggcaccaaacgtctcgtcgaaaagagcggc
gtcgacgaggaactgatcctgcgtttctcgggcttctttgccgcgcgcaaccgcaatgcc
gtcaatctccgcgccatgctctgcgaattcagtggcctgccggtggagatcgaattgttc
cgcggccgctggcttaccatcccgatcgaggagcgcagccgcatcggccagccccagggc
gtccagcttggcgtcaatgcgacggcaggtgctgcgatccacgatttcagcggcggcttt
cgcatcgtcatcggtccgctcggttatgccgactacctctcgctcgcgccgggcggccgc
gccatcaccgaactcttcgccctggcgcggctctatgtcggtgcggcgctcgaattcgac
atacaggcgatcctgaagaaggaggacgttcccttctgccagctcggacaggcgggcgat
ccgccgcggcttggctggaacagttgggcgagggttgcgccggctgcaagcgacagcggc
gatgcagtgatcgtcgagcgcctgtcggttcaggcgcggtga

DBGET integrated database retrieval system