KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120477Help
Entry
pRL120477         CDS       T00402                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11903  
type VI secretion system secreted protein Hcp
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rle00001]
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    pRL120477
Secretion system [BR:rle02044]
 Type VI secretion system
  Imp/Vas secretion system core components [MD:M00334]
   pRL120477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL12:517603..518079
Genome map
AA seq 158 aa AA seqDB search
MPIYLQIDGIQGDATHEQHRKWMDIEAIHWNVARNMNTSAGSAANREASEPTVSEVILTK
VSDSSSTKLFQEACSGRTGKRSVIHLVTTGNPGDTYIEYSLENTLIASYSIDSNGDRPVE
TIKLNFTKMEVKYTPYDDKHSPQSPMIASYDLATTKAA
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgccgatttatcttcagatcgacggtatccagggggatgctacccacgagcagcatcgc
aaatggatggatatcgaagccatccactggaatgtagcccgcaacatgaacacgtccgct
ggttcggcggcgaaccgtgaagcttccgagccgaccgtttcggaagtgatcctcaccaag
gtcagcgactcctcgtcgaccaagcttttccaggaggcctgctcgggccgtaccggcaag
cgctccgtcatccatctcgtcaccacgggcaatcctggcgacacctatatcgagtactcc
ctcgaaaatacgctgatcgccagctactcgatcgattccaacggcgaccgcccggtcgag
acgatcaagctgaacttcaccaagatggaagtgaagtacacgccttacgacgacaagcac
tcgccgcagtcgccgatgatcgcttcttacgatctcgcgaccaccaaggccgcttaa

DBGET integrated database retrieval system