KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120485Help
Entry
pRL120485         CDS       T00402                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GAD-like DUF1851
Motif
Other DBs
NCBI-ProteinID: CAK12194
GeneDB: pRL120485
RhizoBase: pRL120485
UniProt: Q1M3Y0
Position
pRL12:527666..528412
Genome map
AA seq 248 aa AA seqDB search
MSATPRRPLQEILDEFGPLKDGMAVAASQAEGYRGKLPDAMVDFWIEHGRGQWRDGLFWI
CDPEPIMPVLHALFAGDPEFDAARMVPFMRDAFGEVSVWHPKFKLITLKMNLGTVTTTDI
TTHVIEGVPPFDDDMAVAAAVDASVFDGRGWVDATTGKPVFDAVRRRLGPISADQVYTMV
PHFRLGGDGAARDFSIGGFIEYLGVLAQIGSFTLERYIDPKQGGRGPFGHLEAVRTIGHD
RLIDRDTL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctaccccccggcgccccttacaggaaatattggatgaattcggaccgctcaaa
gacggtatggcggttgctgcttcgcaggctgagggctatcgcgggaagctgcctgacgcg
atggttgatttctggattgagcatggtcgcgggcaatggcgcgacggtcttttctggatc
tgcgatcctgagccgatcatgcctgtcctgcatgcgctgtttgcaggcgatccggaattc
gacgccgcaagaatggtgcccttcatgcgtgatgcgttcggcgaagtcagcgtctggcat
ccgaagttcaagctgatcacgctcaagatgaatctcggcaccgtcaccaccacagacatt
accacccacgtcattgaaggcgtacctcccttcgacgacgatatggcggtagctgccgcc
gtggacgccagcgttttcgatggtcgtggctgggtggatgctaccactggcaagcccgtt
ttcgatgcggttcgccggcgacttgggccgatcagcgctgatcaggtctatactatggtc
ccgcatttccgcctcggcggcgatggcgctgccagggatttttcaatcggcggcttcatc
gaatatctgggcgttctggcgcagataggatcctttacgctcgaacgctatatcgatccg
aagcagggtggccgaggaccctttggacatctcgaggctgtccgtacgatcggacacgac
cgtctgatcgatagggacacactatga

DBGET integrated database retrieval system